BLASTX nr result
ID: Ziziphus21_contig00014913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00014913 (202 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011004144.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_006381507.1| pentatricopeptide repeat-containing family p... 63 1e-07 gb|KDO51904.1| hypothetical protein CISIN_1g003082mg [Citrus sin... 60 5e-07 gb|KDO51903.1| hypothetical protein CISIN_1g003082mg [Citrus sin... 60 5e-07 gb|KDO51902.1| hypothetical protein CISIN_1g003082mg [Citrus sin... 60 5e-07 ref|XP_008242918.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_007208081.1| hypothetical protein PRUPE_ppa001520mg [Prun... 60 8e-07 ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006428907.1| hypothetical protein CICLE_v10011055mg [Citr... 59 1e-06 ref|XP_002525196.1| pentatricopeptide repeat-containing protein,... 59 1e-06 ref|XP_008447199.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_008447192.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_010037924.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_010037923.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 gb|KCW49699.1| hypothetical protein EUGRSUZ_K03203 [Eucalyptus g... 57 4e-06 ref|XP_010100837.1| hypothetical protein L484_003853 [Morus nota... 57 5e-06 ref|XP_010558287.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 gb|KRH67629.1| hypothetical protein GLYMA_03G177000 [Glycine max] 57 7e-06 ref|XP_006577707.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_011004144.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Populus euphratica] Length = 854 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YKSNDYYLKQLIEEWCEGV QDNNQ QG + C Sbjct: 653 YKSNDYYLKQLIEEWCEGVIQDNNQIQGGFASC 685 >ref|XP_006381507.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336211|gb|ERP59304.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 828 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YKSNDYYLKQLIEEWCEGV QDNNQ QG + C Sbjct: 649 YKSNDYYLKQLIEEWCEGVIQDNNQIQGGFASC 681 >gb|KDO51904.1| hypothetical protein CISIN_1g003082mg [Citrus sinensis] Length = 723 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YK+ND YLK+LIEEWCEGV QD NQNQGE++ C Sbjct: 652 YKANDTYLKELIEEWCEGVIQDKNQNQGEVTLC 684 >gb|KDO51903.1| hypothetical protein CISIN_1g003082mg [Citrus sinensis] Length = 750 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YK+ND YLK+LIEEWCEGV QD NQNQGE++ C Sbjct: 652 YKANDTYLKELIEEWCEGVIQDKNQNQGEVTLC 684 >gb|KDO51902.1| hypothetical protein CISIN_1g003082mg [Citrus sinensis] Length = 850 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YK+ND YLK+LIEEWCEGV QD NQNQGE++ C Sbjct: 652 YKANDTYLKELIEEWCEGVIQDKNQNQGEVTLC 684 >ref|XP_008242918.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Prunus mume] Length = 824 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPCIK 3 YKSNDYYL+QLIEEWCEGV QD+N Q E S C K Sbjct: 621 YKSNDYYLEQLIEEWCEGVIQDSNAKQEEFSSCNK 655 >ref|XP_007208081.1| hypothetical protein PRUPE_ppa001520mg [Prunus persica] gi|462403723|gb|EMJ09280.1| hypothetical protein PRUPE_ppa001520mg [Prunus persica] Length = 809 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPCIK 3 YKSNDYYL+QLIEEWCEGV QD+N Q E S C K Sbjct: 608 YKSNDYYLEQLIEEWCEGVIQDSNAKQEEFSSCNK 642 >ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Vitis vinifera] Length = 852 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YKSNDYYLK+LIEEWCEGV QDNN NQ + S Sbjct: 648 YKSNDYYLKELIEEWCEGVIQDNNLNQSKFS 678 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Length = 842 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YKSNDYYLK+LIEEWCEGV QDNN NQ + S Sbjct: 638 YKSNDYYLKELIEEWCEGVIQDNNLNQSKFS 668 >ref|XP_006428907.1| hypothetical protein CICLE_v10011055mg [Citrus clementina] gi|568853887|ref|XP_006480569.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Citrus sinensis] gi|557530964|gb|ESR42147.1| hypothetical protein CICLE_v10011055mg [Citrus clementina] Length = 850 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YK+ND YLK++IEEWCEGV QD NQNQGE++ C Sbjct: 652 YKANDTYLKEVIEEWCEGVIQDKNQNQGEVTLC 684 >ref|XP_002525196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535493|gb|EEF37162.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 786 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPC 9 YKSND YLKQLIEEWCEGV QDN+Q Q + PC Sbjct: 585 YKSNDNYLKQLIEEWCEGVIQDNDQCQDDFKPC 617 >ref|XP_008447199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Cucumis melo] Length = 748 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPCIK 3 +KSND+YLK+LI EWCEGV Q+NNQ Q E +PC K Sbjct: 657 FKSNDHYLKELIAEWCEGVLQNNNQQQVETTPCNK 691 >ref|XP_008447192.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Cucumis melo] Length = 850 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELSPCIK 3 +KSND+YLK+LI EWCEGV Q+NNQ Q E +PC K Sbjct: 657 FKSNDHYLKELIAEWCEGVLQNNNQQQVETTPCNK 691 >ref|XP_010037924.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Eucalyptus grandis] Length = 820 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YK ND+YLK LIEEWCEGV QDN+ NQGE+S Sbjct: 646 YKPNDHYLKALIEEWCEGVIQDNDMNQGEVS 676 >ref|XP_010037923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Eucalyptus grandis] Length = 822 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YK ND+YLK LIEEWCEGV QDN+ NQGE+S Sbjct: 648 YKPNDHYLKALIEEWCEGVIQDNDMNQGEVS 678 >gb|KCW49699.1| hypothetical protein EUGRSUZ_K03203 [Eucalyptus grandis] Length = 570 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YK ND+YLK LIEEWCEGV QDN+ NQGE+S Sbjct: 396 YKPNDHYLKALIEEWCEGVIQDNDMNQGEVS 426 >ref|XP_010100837.1| hypothetical protein L484_003853 [Morus notabilis] gi|587896335|gb|EXB84820.1| hypothetical protein L484_003853 [Morus notabilis] Length = 822 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 Y SNDYYLKQLIEEWCEGV Q NNQN+ E S Sbjct: 625 YNSNDYYLKQLIEEWCEGVIQGNNQNREESS 655 >ref|XP_010558287.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Tarenaya hassleriana] Length = 872 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 119 VYHRYKSNDYYLKQLIEEWCEGVTQDNNQNQ 27 +YHRYK NDY+LK+LIEEWCEGV Q+++ NQ Sbjct: 669 LYHRYKPNDYFLKELIEEWCEGVIQEDSYNQ 699 >gb|KRH67629.1| hypothetical protein GLYMA_03G177000 [Glycine max] Length = 544 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YK NDYYL++LIEEWCEGV QDN + QGE S Sbjct: 323 YKPNDYYLEELIEEWCEGVIQDNREKQGEFS 353 >ref|XP_006577707.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Length = 597 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 107 YKSNDYYLKQLIEEWCEGVTQDNNQNQGELS 15 YK NDYYL++LIEEWCEGV QDN + QGE S Sbjct: 403 YKPNDYYLEELIEEWCEGVIQDNREKQGEFS 433