BLASTX nr result
ID: Ziziphus21_contig00014909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00014909 (950 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 63 1e-11 ref|XP_002513355.1| conserved hypothetical protein [Ricinus comm... 45 8e-08 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 45 2e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 gb|KJB20616.1| hypothetical protein B456_003G156400 [Gossypium r... 60 2e-06 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 63.2 bits (152), Expect(3) = 1e-11 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 228 HTIWFFAQMTRFVPWRAPREAGFTEQRPPPSPGSGRITGRC 106 H + A+ T + WRAPREAGFTEQR PP+PGSGRITGRC Sbjct: 82 HVVRAKARATCVLKWRAPREAGFTEQRKPPAPGSGRITGRC 122 Score = 29.3 bits (64), Expect(3) = 1e-11 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 388 TESPGSVTRACNQSWGIKVL 329 T SP SV RAC+ S GIKV+ Sbjct: 36 TSSPSSVARACDPSGGIKVV 55 Score = 25.0 bits (53), Expect(3) = 1e-11 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 302 GLGRLTSGPSVPSQE 258 GL RL SGP VPS+E Sbjct: 65 GLQRLLSGPPVPSRE 79 >ref|XP_002513355.1| conserved hypothetical protein [Ricinus communis] gi|223547263|gb|EEF48758.1| conserved hypothetical protein [Ricinus communis] Length = 102 Score = 44.7 bits (104), Expect(2) = 8e-08 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = -2 Query: 391 RTESPGSVTRACNQSWGIKVLRHCRGPLVWV*GGSLLAHLFQAKSRRALWFG 236 + SPGSVTRACN S G+KV+ H P + G LA FQA S W G Sbjct: 20 KASSPGSVTRACNPSGGVKVMEHWASPRSRIVNGYCLACPFQAVSE---WCG 68 Score = 40.4 bits (93), Expect(2) = 8e-08 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -1 Query: 185 GGHRVRLASQSSDHLPLLAVEG 120 GG+RVRLASQSSD+LPL AVEG Sbjct: 81 GGYRVRLASQSSDNLPLTAVEG 102 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +2 Query: 107 HRPVILPLPGEGGGRCSVKPASRGALHGTNLV--IWAKNHI 223 H+ VILPLP GG RCSVKPASR AL N V +A+ HI Sbjct: 17 HQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHI 57 Score = 38.5 bits (88), Expect(2) = 2e-07 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = +3 Query: 267 WNRWARSEPP*TQTSGPRQCLNTLIPQLWLQALVTEPGD 383 WN AR++P + +GP Q TL+P L LQA TEPGD Sbjct: 63 WNGRARAQPHQGRPTGPEQRPITLMPLLRLQAHATEPGD 101 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 58.5 bits (140), Expect(2) = 9e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 184 EGTA*GWLHRAATTSLSWQWKDNGSVLPG 98 EGTA GW HRAA TSLSWQWKDNG VLPG Sbjct: 28 EGTALGWFHRAAITSLSWQWKDNGPVLPG 56 Score = 23.1 bits (48), Expect(2) = 9e-07 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 282 WPICSKPRAEEPCGLGEG 229 W SK R + PCGLGEG Sbjct: 3 WLARSKLRVD-PCGLGEG 19 >gb|KJB20616.1| hypothetical protein B456_003G156400 [Gossypium raimondii] Length = 127 Score = 60.5 bits (145), Expect = 2e-06 Identities = 42/91 (46%), Positives = 49/91 (53%) Frame = +2 Query: 110 RPVILPLPGEGGGRCSVKPASRGALHGTNLVIWAKNHIVWPSPKPQGSSALGLEQMGQK* 289 +PVILPL EGG RCSVKPASR ALH N + SP Q + G ++G Sbjct: 35 KPVILPLLREGGLRCSVKPASRSALHLRN----HETQSFHSSPSVQLLAWNGQARLG--- 87 Query: 290 ASLDPNKWAATMSQHLNTPTLVTGPRY*ARR 382 + DP A+ M HL PT VT RY ARR Sbjct: 88 PTPDPILQASPMFHHLKAPTQVTSKRYQARR 118