BLASTX nr result
ID: Ziziphus21_contig00014866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00014866 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN23001.1| 60S ribosomal protein L13a-4 [Glycine soja] 67 4e-09 ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycin... 67 4e-09 ref|XP_012473585.1| PREDICTED: 60S ribosomal protein L13a-4 [Gos... 67 5e-09 ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like... 67 5e-09 ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Cam... 67 5e-09 ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like... 67 5e-09 ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, part... 67 5e-09 ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobr... 67 5e-09 ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thali... 67 7e-09 ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyra... 67 7e-09 dbj|BAF01678.1| 60S ribosomal protein L13a [Arabidopsis thaliana] 67 7e-09 gb|KRH07489.1| hypothetical protein GLYMA_16G092800 [Glycine max] 66 1e-08 ref|XP_012490832.1| PREDICTED: 60S ribosomal protein L13a-4-like... 66 1e-08 gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja] 66 1e-08 ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like... 66 1e-08 ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Cam... 66 1e-08 ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phas... 66 1e-08 ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutr... 66 1e-08 ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Caps... 66 1e-08 ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Caps... 66 1e-08 >gb|KHN23001.1| 60S ribosomal protein L13a-4 [Glycine soja] Length = 150 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG+QLDVLAPVKY Sbjct: 117 YERKKQLNKLRVKAEKVAEEKLGSQLDVLAPVKY 150 >ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max] gi|255628253|gb|ACU14471.1| unknown [Glycine max] gi|947088127|gb|KRH36792.1| hypothetical protein GLYMA_09G024000 [Glycine max] Length = 206 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG+QLDVLAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGSQLDVLAPVKY 206 >ref|XP_012473585.1| PREDICTED: 60S ribosomal protein L13a-4 [Gossypium raimondii] gi|728837038|gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum] gi|763755313|gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii] Length = 206 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 381 AYERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 AYERKKQLNKLRVKAEK AEEKLG+QLD+LAPVKY Sbjct: 172 AYERKKQLNKLRVKAEKTAEEKLGSQLDILAPVKY 206 >ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa] Length = 206 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG QLDVLAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGAQLDVLAPVKY 206 >ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa] gi|727536432|ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa] Length = 206 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG QLDVLAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGAQLDVLAPVKY 206 >ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis] gi|641847047|gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis] Length = 206 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 381 AYERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 AYERKKQLNKLR KAEKVAEEKLG+QLD+LAPVKY Sbjct: 172 AYERKKQLNKLRAKAEKVAEEKLGSQLDILAPVKY 206 >ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina] gi|557545864|gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina] Length = 382 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 381 AYERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 AYERKKQLNKLR KAEKVAEEKLG+QLD+LAPVKY Sbjct: 348 AYERKKQLNKLRAKAEKVAEEKLGSQLDILAPVKY 382 >ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao] gi|508702037|gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao] Length = 206 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 381 AYERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 AYERKKQLNKLRVKAEK AEEKLG+QLD+LAPVKY Sbjct: 172 AYERKKQLNKLRVKAEKAAEEKLGSQLDILAPVKY 206 >ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|145334783|ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|17865558|sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 gi|9758875|dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana] gi|19699305|gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana] gi|21593767|gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana] gi|21689627|gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana] gi|332008337|gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|332008338|gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] Length = 206 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG QLD+LAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY 206 >ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata] gi|297311504|gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata] Length = 206 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG QLD+LAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY 206 >dbj|BAF01678.1| 60S ribosomal protein L13a [Arabidopsis thaliana] Length = 41 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAEEKLG QLD+LAPVKY Sbjct: 8 YERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY 41 >gb|KRH07489.1| hypothetical protein GLYMA_16G092800 [Glycine max] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAE+KLG+QLD+LAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVAEDKLGSQLDILAPVKY 206 >ref|XP_012490832.1| PREDICTED: 60S ribosomal protein L13a-4-like [Gossypium raimondii] gi|763775346|gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 381 AYERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 AYERKK+LNKLRVKAEK AEEKLG+QLD+LAPVKY Sbjct: 172 AYERKKELNKLRVKAEKAAEEKLGSQLDILAPVKY 206 >gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja] Length = 204 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVAE+KLG+QLD+LAPVKY Sbjct: 171 YERKKQLNKLRVKAEKVAEDKLGSQLDILAPVKY 204 >ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLR KAEKVAEEKLG+QLDVLAPVKY Sbjct: 173 YERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY 206 >ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa] gi|727630543|ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLR KAEKVAEEKLG+QLDVLAPVKY Sbjct: 173 YERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY 206 >ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris] gi|561020709|gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLRVKAEKVA+EKLG+QLD+LAPVKY Sbjct: 173 YERKKQLNKLRVKAEKVADEKLGSQLDILAPVKY 206 >ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum] gi|557109014|gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLR KAEKVAEEKLG+QLDVLAPVKY Sbjct: 173 YERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY 206 >ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella] gi|482567276|gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQLNKLR KAEKVAEEKLG+QLDVLAPVKY Sbjct: 173 YERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY 206 >ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella] gi|482549815|gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 378 YERKKQLNKLRVKAEKVAEEKLGTQLDVLAPVKY 277 YERKKQ+NKLRVKAEKVAEEKLG QLD+LAPVKY Sbjct: 173 YERKKQINKLRVKAEKVAEEKLGAQLDILAPVKY 206