BLASTX nr result
ID: Ziziphus21_contig00014779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00014779 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010087187.1| Zinc finger CCCH domain-containing protein 7... 59 2e-06 >ref|XP_010087187.1| Zinc finger CCCH domain-containing protein 7 [Morus notabilis] gi|587837689|gb|EXB28444.1| Zinc finger CCCH domain-containing protein 7 [Morus notabilis] Length = 2046 Score = 58.5 bits (140), Expect = 2e-06 Identities = 39/84 (46%), Positives = 45/84 (53%) Frame = -2 Query: 288 SVGDIGLSSSGESIMDADTDASQHGRGSICVSGSGCSNYEENIIISDSQPIDCAARKPSQ 109 SV GL SSGES MDA T R + + + SNYEE I IS S +DC +P Sbjct: 812 SVTICGLPSSGESTMDAHTSHHDSDRRT-SLGYNNESNYEE-ITISRSGIVDCIIEQPPT 869 Query: 108 DGAIALPENGGTGKSPKHKISVGD 37 D + LPEN G S KISVGD Sbjct: 870 DSSSGLPENSAIGSSQNTKISVGD 893