BLASTX nr result
ID: Ziziphus21_contig00013637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013637 (414 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009180415.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-15 ref|YP_009180232.1| Ycf2 (chloroplast) [Dendrobium huoshanense] ... 87 6e-15 ref|YP_009179099.1| Ycf2 (chloroplast) [Ostrya rehderiana] gi|94... 87 6e-15 ref|YP_009179117.1| Ycf2 (chloroplast) [Ostrya rehderiana] gi|94... 87 6e-15 ref|YP_009176552.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-15 gb|ALG65750.1| hypothetical protein RF2 (chloroplast) [Anoectoch... 87 6e-15 ref|YP_009175240.1| conserved hypothetical protein ycf2 (plastid... 87 6e-15 ref|YP_009175157.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-15 ref|YP_009171726.1| Ycf2 (chloroplast) [Euonymus japonicus] gi|9... 87 6e-15 ref|YP_009169396.1| hypothetical chloroplast RF2 (chloroplast) [... 87 6e-15 ref|YP_009170221.1| hypothetical chloroplast RF21 (plastid) [Col... 87 6e-15 gb|AJA05760.1| hypothetical chloroplast RF21 (plastid) [Castanea... 87 6e-15 ref|YP_009164446.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-15 gb|AKJ83508.1| photosystem I assembly protein Ycf2 (chloroplast)... 87 6e-15 ref|YP_009166269.1| Ycf2 (chloroplast) [Piper kadsura] gi|937408... 87 6e-15 ref|YP_009166167.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] g... 87 6e-15 ref|YP_009164360.1| Ycf2 (chloroplast) [Bupleurum falcatum] gi|9... 87 6e-15 ref|YP_009163523.1| hypothetical chloroplast RF21 (plastid) [Eug... 87 6e-15 gb|AKU70820.1| hypothetical chloroplast RF21 (chloroplast) [Pana... 87 6e-15 ref|YP_009161148.1| Ycf2 (chloroplast) [Lilium tsingtauense] gi|... 87 6e-15 >ref|YP_009180415.1| hypothetical chloroplast RF21 (chloroplast) [Musa balbisiana] gi|953358261|ref|YP_009180435.1| hypothetical chloroplast RF21 (chloroplast) [Musa balbisiana] gi|944544193|gb|ALL97083.1| hypothetical chloroplast RF21 (chloroplast) [Musa balbisiana] gi|944544212|gb|ALL97102.1| hypothetical chloroplast RF21 (chloroplast) [Musa balbisiana] Length = 2340 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1581 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1622 >ref|YP_009180232.1| Ycf2 (chloroplast) [Dendrobium huoshanense] gi|953244991|ref|YP_009180242.1| Ycf2 (chloroplast) [Dendrobium huoshanense] gi|944543357|gb|ALL96546.1| Ycf2 (chloroplast) [Dendrobium huoshanense] gi|944543358|gb|ALL96547.1| Ycf2 (chloroplast) [Dendrobium huoshanense] Length = 2294 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1513 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1554 >ref|YP_009179099.1| Ycf2 (chloroplast) [Ostrya rehderiana] gi|940813757|gb|ALK26657.1| Ycf2 (chloroplast) [Ostrya rehderiana] Length = 2273 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1516 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1557 >ref|YP_009179117.1| Ycf2 (chloroplast) [Ostrya rehderiana] gi|940813750|gb|ALK26650.1| Ycf2 (chloroplast) [Ostrya rehderiana] Length = 2273 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1516 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1557 >ref|YP_009176552.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia aff. bouchei HTK-2015] gi|944542624|ref|YP_009176569.1| Ycf2 (chloroplast) [Sobralia aff. bouchei HTK-2015] gi|937957643|gb|ALJ02025.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia aff. bouchei HTK-2015] gi|937957658|gb|ALJ02040.1| Ycf2 (chloroplast) [Sobralia aff. bouchei HTK-2015] Length = 2307 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1527 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1568 >gb|ALG65750.1| hypothetical protein RF2 (chloroplast) [Anoectochilus roxburghii] Length = 2287 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1513 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1554 >ref|YP_009175240.1| conserved hypothetical protein ycf2 (plastid) [Oncidium sphacelatum] gi|944543234|ref|YP_009175249.1| conserved hypothetical protein ycf2 (plastid) [Oncidium sphacelatum] gi|694174820|gb|AIS67495.1| conserved hypothetical protein ycf2 (plastid) [Oncidium sphacelatum] gi|694174828|gb|AIS67503.1| conserved hypothetical protein ycf2 (plastid) [Oncidium sphacelatum] Length = 2233 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1459 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1500 >ref|YP_009175157.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia callosa] gi|944543163|ref|YP_009175174.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia callosa] gi|694174740|gb|AIS67416.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia callosa] gi|694174757|gb|AIS67433.1| hypothetical chloroplast RF21 (chloroplast) [Sobralia callosa] Length = 2304 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1527 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1568 >ref|YP_009171726.1| Ycf2 (chloroplast) [Euonymus japonicus] gi|938339613|ref|YP_009171745.1| hypothetical protein RF2 (chloroplast) [Euonymus japonicus] gi|817161785|gb|AKF33765.1| Ycf2 (chloroplast) [Euonymus japonicus] gi|817161804|gb|AKF33784.1| hypothetical protein RF2 (chloroplast) [Euonymus japonicus] Length = 2274 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1517 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1558 >ref|YP_009169396.1| hypothetical chloroplast RF2 (chloroplast) [Clematis terniflora] gi|937546418|ref|YP_009169412.1| hypothetical chloroplast RF2 (chloroplast) [Clematis terniflora] gi|687814895|gb|AIQ81137.1| hypothetical chloroplast RF2 (chloroplast) [Clematis terniflora] gi|687814911|gb|AIQ81153.1| hypothetical chloroplast RF2 (chloroplast) [Clematis terniflora] Length = 2277 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1502 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1543 >ref|YP_009170221.1| hypothetical chloroplast RF21 (plastid) [Colpothrinax cookii] gi|937547270|ref|YP_009170238.1| hypothetical chloroplast RF21 (plastid) [Colpothrinax cookii] gi|927679634|gb|ALE29011.1| hypothetical chloroplast RF21 (plastid) [Colpothrinax cookii] gi|927679652|gb|ALE29029.1| hypothetical chloroplast RF21 (plastid) [Colpothrinax cookii] Length = 2301 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1524 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1565 >gb|AJA05760.1| hypothetical chloroplast RF21 (plastid) [Castanea pumila var. pumila] gi|734521382|gb|AJA05778.1| hypothetical chloroplast RF21 (plastid) [Castanea pumila var. pumila] Length = 2277 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1523 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1564 >ref|YP_009164446.1| hypothetical chloroplast RF21 (chloroplast) [Leontopodium leiolepis] gi|927372171|ref|YP_009164463.1| hypothetical chloroplast RF21 (chloroplast) [Leontopodium leiolepis] gi|732663389|gb|AIZ76858.1| hypothetical chloroplast RF21 (chloroplast) [Leontopodium leiolepis] gi|732663406|gb|AIZ76875.1| hypothetical chloroplast RF21 (chloroplast) [Leontopodium leiolepis] Length = 2215 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1433 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1474 >gb|AKJ83508.1| photosystem I assembly protein Ycf2 (chloroplast) [Alocasia macrorrhizos] gi|827505232|gb|AKJ83509.1| photosystem I assembly protein Ycf2 (chloroplast) [Alocasia macrorrhizos] Length = 2287 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1513 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1554 >ref|YP_009166269.1| Ycf2 (chloroplast) [Piper kadsura] gi|937408012|ref|YP_009166286.1| Ycf2 (chloroplast) [Piper kadsura] gi|918056523|gb|AKZ89407.1| Ycf2 (chloroplast) [Piper kadsura] gi|918056524|gb|AKZ89408.1| Ycf2 (chloroplast) [Piper kadsura] Length = 2310 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1533 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1574 >ref|YP_009166167.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|937407990|ref|YP_009166187.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|918056467|gb|AKZ89364.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|918056487|gb|AKZ89384.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] Length = 2284 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1517 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1558 >ref|YP_009164360.1| Ycf2 (chloroplast) [Bupleurum falcatum] gi|927372085|ref|YP_009164378.1| Ycf2 (chloroplast) [Bupleurum falcatum] gi|728802727|gb|AIY72346.1| Ycf2 (chloroplast) [Bupleurum falcatum] gi|728802745|gb|AIY72364.1| Ycf2 (chloroplast) [Bupleurum falcatum] Length = 2100 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1328 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1369 >ref|YP_009163523.1| hypothetical chloroplast RF21 (plastid) [Eugenia uniflora] gi|918021147|ref|YP_009163540.1| hypothetical chloroplast RF21 (plastid) [Eugenia uniflora] gi|913022822|gb|AKU71520.1| hypothetical chloroplast RF21 (plastid) [Eugenia uniflora] gi|913022839|gb|AKU71537.1| hypothetical chloroplast RF21 (plastid) [Eugenia uniflora] Length = 2286 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1518 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1559 >gb|AKU70820.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|913021677|gb|AKU70840.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] Length = 2115 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1331 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1372 >ref|YP_009161148.1| Ycf2 (chloroplast) [Lilium tsingtauense] gi|910354838|ref|YP_009161166.1| Ycf2 (chloroplast) [Lilium tsingtauense] gi|910355499|ref|YP_009161499.1| Ycf2 (chloroplast) [Lilium sp. KHK-2014] gi|910355517|ref|YP_009161517.1| Ycf2 (chloroplast) [Lilium sp. KHK-2014] gi|743432455|gb|AJC09016.1| Ycf2 (chloroplast) [Lilium tsingtauense] gi|743432473|gb|AJC09034.1| Ycf2 (chloroplast) [Lilium tsingtauense] gi|743434605|gb|AJC10748.1| Ycf2 (chloroplast) [Lilium sp. KHK-2014] gi|743434623|gb|AJC10766.1| Ycf2 (chloroplast) [Lilium sp. KHK-2014] Length = 2210 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 286 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 411 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG Sbjct: 1432 EFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYQMIEQPG 1473