BLASTX nr result
ID: Ziziphus21_contig00013570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013570 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106675.1| RNA-binding protein with multiple splicing [... 91 3e-16 ref|XP_007215635.1| hypothetical protein PRUPE_ppa008170mg [Prun... 89 2e-15 ref|XP_009367543.1| PREDICTED: U2 small nuclear ribonucleoprotei... 87 5e-15 ref|XP_009367542.1| PREDICTED: U2 small nuclear ribonucleoprotei... 87 5e-15 ref|XP_008228314.1| PREDICTED: U2 small nuclear ribonucleoprotei... 86 8e-15 ref|XP_008228313.1| PREDICTED: U2 small nuclear ribonucleoprotei... 86 8e-15 ref|XP_008391315.1| PREDICTED: nucleolin isoform X2 [Malus domes... 86 1e-14 ref|XP_008391314.1| PREDICTED: uncharacterized protein LOC103453... 86 1e-14 ref|XP_004297607.1| PREDICTED: protein WHI4 [Fragaria vesca subs... 78 3e-12 gb|KDO65304.1| hypothetical protein CISIN_1g023143mg [Citrus sin... 73 9e-11 ref|XP_006466053.1| PREDICTED: U2 small nuclear ribonucleoprotei... 73 9e-11 ref|XP_006426509.1| hypothetical protein CICLE_v10026213mg [Citr... 73 9e-11 ref|XP_006426508.1| hypothetical protein CICLE_v10026213mg [Citr... 73 9e-11 ref|XP_008462363.1| PREDICTED: LOW QUALITY PROTEIN: U2 small nuc... 72 1e-10 gb|ADN34103.1| hypothetical protein [Cucumis melo subsp. melo] 72 1e-10 ref|XP_013737782.1| PREDICTED: uncharacterized protein LOC106440... 71 3e-10 ref|XP_013586380.1| PREDICTED: uncharacterized protein LOC106295... 71 3e-10 emb|CDY23631.1| BnaC05g39630D [Brassica napus] 71 3e-10 ref|XP_014516111.1| PREDICTED: uncharacterized protein LOC106773... 71 4e-10 gb|KOM30231.1| hypothetical protein LR48_Vigan1082s000300 [Vigna... 71 4e-10 >ref|XP_010106675.1| RNA-binding protein with multiple splicing [Morus notabilis] gi|587923793|gb|EXC11124.1| RNA-binding protein with multiple splicing [Morus notabilis] Length = 284 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPY+PYYLH QQPPPI QD D AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYEPYYLHHQQPPPI-QDSKDRNAINTLFVSGLPDDVKAREIHNLFRR 51 >ref|XP_007215635.1| hypothetical protein PRUPE_ppa008170mg [Prunus persica] gi|462411785|gb|EMJ16834.1| hypothetical protein PRUPE_ppa008170mg [Prunus persica] Length = 342 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/58 (74%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -1 Query: 173 SAVGQMSQPPYDPYYLHLQQP-PPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 S QM+ PP+DPYYL Q P PP QDFSD + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 58 SGRNQMAHPPHDPYYLQQQPPLPPQQQDFSDRSVINTLFVSGLPDDVKAREIHNLFRR 115 >ref|XP_009367543.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 [Pyrus x bretschneideri] Length = 282 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/55 (76%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQ---PPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL Q PPP QD+SD +AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYDPYYLQQQPQPVPPPQPQDYSDRSAINTLFVSGLPDDVKAREIHNLFRR 55 >ref|XP_009367542.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 [Pyrus x bretschneideri] Length = 288 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/55 (76%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQ---PPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL Q PPP QD+SD +AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYDPYYLQQQPQPVPPPQPQDYSDRSAINTLFVSGLPDDVKAREIHNLFRR 55 >ref|XP_008228314.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 [Prunus mume] Length = 338 Score = 86.3 bits (212), Expect = 8e-15 Identities = 41/58 (70%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -1 Query: 173 SAVGQMSQPPYDPYYLHLQQP-PPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 S +M+ PP+DPYYL Q P PP QD+SD + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 55 SGRNEMAHPPHDPYYLQQQPPLPPQQQDYSDRSVINTLFVSGLPDDVKAREIHNLFRR 112 >ref|XP_008228313.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 [Prunus mume] Length = 339 Score = 86.3 bits (212), Expect = 8e-15 Identities = 41/58 (70%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -1 Query: 173 SAVGQMSQPPYDPYYLHLQQP-PPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 S +M+ PP+DPYYL Q P PP QD+SD + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 55 SGRNEMAHPPHDPYYLQQQPPLPPQQQDYSDRSVINTLFVSGLPDDVKAREIHNLFRR 112 >ref|XP_008391315.1| PREDICTED: nucleolin isoform X2 [Malus domestica] Length = 278 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL QP P QD+SD +AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYDPYYLQ-PQPQPQPQDYSDRSAINTLFVSGLPDDVKAREIHNLFRR 51 >ref|XP_008391314.1| PREDICTED: uncharacterized protein LOC103453553 isoform X1 [Malus domestica] Length = 284 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL QP P QD+SD +AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYDPYYLQ-PQPQPQPQDYSDRSAINTLFVSGLPDDVKAREIHNLFRR 51 >ref|XP_004297607.1| PREDICTED: protein WHI4 [Fragaria vesca subsp. vesca] Length = 275 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL P P D+S+ + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAHPPYDPYYL----PQPQQPDYSNRSVINTLFVSGLPDDVKAREIHNLFRR 48 >gb|KDO65304.1| hypothetical protein CISIN_1g023143mg [Citrus sinensis] Length = 284 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/59 (64%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPP-------IHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL PPP H DN INTLFVSGLPDDV+AREIHNLFRR Sbjct: 1 MAHPPYDPYYLPPIHPPPPPVPPPPYHHQQQDN-GINTLFVSGLPDDVRAREIHNLFRR 58 >ref|XP_006466053.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Citrus sinensis] gi|641846419|gb|KDO65303.1| hypothetical protein CISIN_1g023143mg [Citrus sinensis] Length = 286 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/59 (64%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPP-------IHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL PPP H DN INTLFVSGLPDDV+AREIHNLFRR Sbjct: 1 MAHPPYDPYYLPPIHPPPPPVPPPPYHHQQQDN-GINTLFVSGLPDDVRAREIHNLFRR 58 >ref|XP_006426509.1| hypothetical protein CICLE_v10026213mg [Citrus clementina] gi|557528499|gb|ESR39749.1| hypothetical protein CICLE_v10026213mg [Citrus clementina] Length = 280 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/59 (64%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPP-------IHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL PPP H DN INTLFVSGLPDDV+AREIHNLFRR Sbjct: 1 MAHPPYDPYYLPPIHPPPPPVPPPPYHHQQQDN-GINTLFVSGLPDDVRAREIHNLFRR 58 >ref|XP_006426508.1| hypothetical protein CICLE_v10026213mg [Citrus clementina] gi|557528498|gb|ESR39748.1| hypothetical protein CICLE_v10026213mg [Citrus clementina] Length = 286 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/59 (64%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPP-------IHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PPYDPYYL PPP H DN INTLFVSGLPDDV+AREIHNLFRR Sbjct: 1 MAHPPYDPYYLPPIHPPPPPVPPPPYHHQQQDN-GINTLFVSGLPDDVRAREIHNLFRR 58 >ref|XP_008462363.1| PREDICTED: LOW QUALITY PROTEIN: U2 small nuclear ribonucleoprotein B'' 2 [Cucumis melo] Length = 262 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PYDPYYL+ Q P +SD + INTLF+SGLPDDVKAREIHNLFRR Sbjct: 1 MAHHPYDPYYLYNQPDPT----YSDRSNINTLFISGLPDDVKAREIHNLFRR 48 >gb|ADN34103.1| hypothetical protein [Cucumis melo subsp. melo] Length = 113 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+ PYDPYYL+ Q P +SD + INTLF+SGLPDDVKAREIHNLFRR Sbjct: 1 MAHHPYDPYYLYNQPDPT----YSDRSNINTLFISGLPDDVKAREIHNLFRR 48 >ref|XP_013737782.1| PREDICTED: uncharacterized protein LOC106440612 [Brassica napus] gi|923554739|ref|XP_013737784.1| PREDICTED: uncharacterized protein LOC106440612 [Brassica napus] Length = 279 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -1 Query: 146 PYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 PYDPYY++ P P+ + AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 7 PYDPYYVYNPLPQPLQHFADEPGAINTLFVSGLPDDVKAREIHNLFRR 54 >ref|XP_013586380.1| PREDICTED: uncharacterized protein LOC106295123 [Brassica oleracea var. oleracea] Length = 279 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -1 Query: 146 PYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 PYDPYY++ P P+ + AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 7 PYDPYYVYNPLPQPLQHFADEPGAINTLFVSGLPDDVKAREIHNLFRR 54 >emb|CDY23631.1| BnaC05g39630D [Brassica napus] Length = 270 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -1 Query: 146 PYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 PYDPYY++ P P+ + AINTLFVSGLPDDVKAREIHNLFRR Sbjct: 7 PYDPYYVYNPLPQPLQHFADEPGAINTLFVSGLPDDVKAREIHNLFRR 54 >ref|XP_014516111.1| PREDICTED: uncharacterized protein LOC106773865 [Vigna radiata var. radiata] Length = 264 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+QPP+DPYYL+ Q D + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAQPPFDPYYLYQQD---------DRSNINTLFVSGLPDDVKAREIHNLFRR 43 >gb|KOM30231.1| hypothetical protein LR48_Vigan1082s000300 [Vigna angularis] Length = 273 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -1 Query: 158 MSQPPYDPYYLHLQQPPPIHQDFSDNTAINTLFVSGLPDDVKAREIHNLFRR 3 M+QPP+DPYYL+ Q D + INTLFVSGLPDDVKAREIHNLFRR Sbjct: 1 MAQPPFDPYYLYQQD---------DRSNINTLFVSGLPDDVKAREIHNLFRR 43