BLASTX nr result
ID: Ziziphus21_contig00013506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013506 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008238458.1| PREDICTED: formyltetrahydrofolate deformylas... 57 5e-06 ref|XP_007209352.1| hypothetical protein PRUPE_ppa008574mg [Prun... 57 5e-06 >ref|XP_008238458.1| PREDICTED: formyltetrahydrofolate deformylase 1, mitochondrial-like [Prunus mume] Length = 326 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -2 Query: 201 PRLVGFANRSFKSLRFPGEXXXXXXXXSLTYGIHAFHCPDPV 76 P+L GFA RSFKSLRFPGE L+YGIH FH PD V Sbjct: 12 PKLFGFAKRSFKSLRFPGEPLDPSSSPILSYGIHVFHAPDAV 53 >ref|XP_007209352.1| hypothetical protein PRUPE_ppa008574mg [Prunus persica] gi|462405087|gb|EMJ10551.1| hypothetical protein PRUPE_ppa008574mg [Prunus persica] Length = 326 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -2 Query: 201 PRLVGFANRSFKSLRFPGEXXXXXXXXSLTYGIHAFHCPDPV 76 P+L GFA RSFKSLRFPGE L+YGIH FH PD V Sbjct: 12 PKLFGFAKRSFKSLRFPGEPLDPSSSPILSYGIHVFHAPDAV 53