BLASTX nr result
ID: Ziziphus21_contig00013382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013382 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008366235.1| PREDICTED: putative disease resistance prote... 57 5e-06 ref|XP_008375297.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 57 7e-06 >ref|XP_008366235.1| PREDICTED: putative disease resistance protein At3g14460 [Malus domestica] Length = 222 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 2 LPEEGLLTSLSQLYINYCPLSTQRCRRQIGED*PNISHIPRI 127 LP+EGLLTSLS+L I C L TQRC+R GED ISHIP++ Sbjct: 140 LPDEGLLTSLSRLVIYRCDLLTQRCQRDTGEDWAKISHIPKV 181 >ref|XP_008375297.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103438539 [Malus domestica] Length = 733 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 11 EGLLTSLSQLYINYCPLSTQRCRRQIGED*PNISHIPRIR 130 EGL TSLS L IN CPL TQRC+ +IGED P ISHI R++ Sbjct: 337 EGLPTSLSHLDINKCPLLTQRCQNEIGEDWPKISHIXRVQ 376