BLASTX nr result
ID: Ziziphus21_contig00013364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013364 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104636.1| Dehydrodolichyl diphosphate synthase 2 [Moru... 60 5e-07 >ref|XP_010104636.1| Dehydrodolichyl diphosphate synthase 2 [Morus notabilis] gi|587913639|gb|EXC01442.1| Dehydrodolichyl diphosphate synthase 2 [Morus notabilis] Length = 316 Score = 60.5 bits (145), Expect = 5e-07 Identities = 36/74 (48%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = -1 Query: 234 MLSLRFPIPVENVLSPANPRHSLSYTSRNQTHLFHSLPLHEPKQLQQRSRRPRATSADVG 55 MLSLR PIP ENV +P P+ S+ QTHLF S L EPK PRAT+AD Sbjct: 1 MLSLRLPIPSENVFTPLKPKPQRFPNSKTQTHLFCSPSLSEPK-----LHLPRATAADAA 55 Query: 54 LKEQ-EQDLNEEAS 16 +KE+ E+ LN+ A+ Sbjct: 56 VKEEREEKLNDGAT 69