BLASTX nr result
ID: Ziziphus21_contig00013196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013196 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 74 3e-11 ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 72 9e-11 ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 72 9e-11 gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial... 72 2e-10 ref|XP_002886851.1| hypothetical protein ARALYDRAFT_893949 [Arab... 47 3e-07 gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlise... 57 7e-06 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 73.6 bits (179), Expect(2) = 3e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 363 LSCHDCNSVHPITKGMNLIQNMNHKRKYRLNRSQEYQLQYLLAKEESFR 217 L H +S+H IT+GMN I+NMNHKRKY LNR QEYQLQYLL+KEESF+ Sbjct: 51 LRFHVDDSIHSITRGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 Score = 21.2 bits (43), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 380 TVEFLRFHV 354 +VEFLRFHV Sbjct: 47 SVEFLRFHV 55 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 72.4 bits (176), Expect(2) = 9e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -2 Query: 363 LSCHDCNSVHPITKGMNLIQNMNHKRKYRLNRSQEYQLQYLLAKEESFR 217 L H +S+H IT GMN I+NMNHKRKY LNR QEYQLQYLL+KEESF+ Sbjct: 51 LRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 Score = 20.8 bits (42), Expect(2) = 9e-11 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 377 VEFLRFHV 354 VEFLRFHV Sbjct: 48 VEFLRFHV 55 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 72.4 bits (176), Expect(2) = 9e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -2 Query: 363 LSCHDCNSVHPITKGMNLIQNMNHKRKYRLNRSQEYQLQYLLAKEESFR 217 L H +S+H IT GMN I+NMNHKRKY LNR QEYQLQYLL+KEESF+ Sbjct: 51 LRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 Score = 20.8 bits (42), Expect(2) = 9e-11 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 377 VEFLRFHV 354 VEFLRFHV Sbjct: 48 VEFLRFHV 55 >gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial [Erythranthe guttata] Length = 82 Score = 71.6 bits (174), Expect = 2e-10 Identities = 40/64 (62%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = -2 Query: 363 LSCHDCNSVHPITK---GMNLIQNMNHKRKYRLNRSQEYQLQYLLAKEESFR*YRPFFLL 193 L H NS+HPIT MNLI+NMNHKRKY +N+SQEYQ YLL+KEESF RPF L Sbjct: 20 LHFHVYNSIHPITNYYIRMNLIRNMNHKRKYLVNQSQEYQQLYLLSKEESF---RPFVPL 76 Query: 192 SSTF 181 S F Sbjct: 77 HSNF 80 >ref|XP_002886851.1| hypothetical protein ARALYDRAFT_893949 [Arabidopsis lyrata subsp. lyrata] gi|297332692|gb|EFH63110.1| hypothetical protein ARALYDRAFT_893949 [Arabidopsis lyrata subsp. lyrata] Length = 85 Score = 47.0 bits (110), Expect(2) = 3e-07 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +2 Query: 227 SSLANRYCNWYSCDRFNRYXXXXXXXXXXXXPLVIG 334 SSL NRYC+WYSCDRFNRY P+ IG Sbjct: 50 SSLGNRYCSWYSCDRFNRYFLLWFIFRIRFIPVEIG 85 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 127 YNLIIIYGCLCL*HDPLMKCGGK*EKWPILPEGFLFG 237 + L++I+ L HD MKCGGK +KW IL EG G Sbjct: 20 WGLLLIF---VLAHDHSMKCGGKRDKWLILLEGSSLG 53 >gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlisea aurea] Length = 81 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/59 (50%), Positives = 33/59 (55%) Frame = +2 Query: 203 NGRYYRKDSSLANRYCNWYSCDRFNRYXXXXXXXXXXXXPLVIG*TELQS*HESVRTQR 379 NGR+Y KDSSL NRYCNWYSCD NRY P+VI +SV TQR Sbjct: 4 NGRHYWKDSSLDNRYCNWYSCDWLNRYFLLWVIFRIRFIPVVI--------TQSVGTQR 54