BLASTX nr result
ID: Ziziphus21_contig00013063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013063 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008233047.1| PREDICTED: pyruvate dehydrogenase E1 compone... 59 1e-06 ref|XP_007218034.1| hypothetical protein PRUPE_ppa006008mg [Prun... 57 4e-06 >ref|XP_008233047.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic isoform X1 [Prunus mume] gi|645254455|ref|XP_008233048.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic isoform X2 [Prunus mume] Length = 431 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -3 Query: 195 MSFSATKFAQPLPLNTTSPRSNDKPTLL--KSSFIGSTQKLRSVPLA 61 MSFSAT AQPL LNT SPRSNDKP+LL SSF+GST+ R L+ Sbjct: 1 MSFSATNLAQPLQLNTASPRSNDKPSLLPKTSSFLGSTRNFRPTSLS 47 >ref|XP_007218034.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica] gi|462414496|gb|EMJ19233.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica] Length = 432 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 3/48 (6%) Frame = -3 Query: 195 MSFSATKFAQPLPLNTTSPRSNDKPTLL---KSSFIGSTQKLRSVPLA 61 MSFSAT AQPL LNT +PRSNDKP+LL SSF+GST+ R L+ Sbjct: 1 MSFSATNLAQPLQLNTATPRSNDKPSLLLPKTSSFLGSTRNFRPTSLS 48