BLASTX nr result
ID: Ziziphus21_contig00013062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00013062 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008233047.1| PREDICTED: pyruvate dehydrogenase E1 compone... 61 4e-07 ref|XP_007218034.1| hypothetical protein PRUPE_ppa006008mg [Prun... 59 1e-06 >ref|XP_008233047.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic isoform X1 [Prunus mume] gi|645254455|ref|XP_008233048.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic isoform X2 [Prunus mume] Length = 431 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = -3 Query: 195 MSFSATKFAQPLPLNTASPRSNDKPTLL--KSSFIGSTQKLRSVPLAS 58 MSFSAT AQPL LNTASPRSNDKP+LL SSF+GST+ R L++ Sbjct: 1 MSFSATNLAQPLQLNTASPRSNDKPSLLPKTSSFLGSTRNFRPTSLSA 48 >ref|XP_007218034.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica] gi|462414496|gb|EMJ19233.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica] Length = 432 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -3 Query: 195 MSFSATKFAQPLPLNTASPRSNDKPTLL---KSSFIGSTQKLRSVPLAS 58 MSFSAT AQPL LNTA+PRSNDKP+LL SSF+GST+ R L++ Sbjct: 1 MSFSATNLAQPLQLNTATPRSNDKPSLLLPKTSSFLGSTRNFRPTSLSA 49