BLASTX nr result
ID: Ziziphus21_contig00012785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00012785 (404 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011465300.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 92 2e-16 ref|XP_010644689.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-16 emb|CBI29222.3| unnamed protein product [Vitis vinifera] 92 2e-16 ref|XP_009342743.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 91 3e-16 ref|XP_007217153.1| hypothetical protein PRUPE_ppa001463mg [Prun... 91 3e-16 ref|XP_009338802.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 ref|XP_008227937.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 gb|KDO46397.1| hypothetical protein CISIN_1g003295mg [Citrus sin... 89 1e-15 ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citr... 89 1e-15 ref|XP_007040906.1| Tetratricopeptide repeat-like superfamily pr... 86 1e-14 ref|XP_002303480.2| pentatricopeptide repeat-containing family p... 85 2e-14 ref|XP_011027990.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_012466482.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 gb|KHG16388.1| hypothetical protein F383_21662 [Gossypium arboreum] 82 2e-13 sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-c... 80 6e-13 emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|72687... 80 6e-13 ref|NP_567587.1| pentatricopeptide repeat-containing protein [Ar... 80 6e-13 gb|KGN53456.1| hypothetical protein Csa_4G055990 [Cucumis sativus] 79 1e-12 ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010449354.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 >ref|XP_011465300.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Fragaria vesca subsp. vesca] Length = 800 Score = 92.0 bits (227), Expect = 2e-16 Identities = 45/69 (65%), Positives = 52/69 (75%) Frame = -3 Query: 303 GLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQ 124 GL +SSVLS P LD S C+S+IP LS FD F+SI SNVNPKT L FFH ASQSF+ Sbjct: 54 GLLNWVSSVLSNPSLDSSKCESLIPLLSPHQFDHLFYSIRSNVNPKTALHFFHFASQSFK 113 Query: 123 FRFTMRSYC 97 FRFT+RS+C Sbjct: 114 FRFTVRSFC 122 >ref|XP_010644689.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] gi|731382358|ref|XP_010644698.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] gi|731382360|ref|XP_010644702.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] Length = 842 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/71 (59%), Positives = 51/71 (71%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 DH L K ++S+LS P LD + CK +IPHLS FD+ FFS+ NVNPKT L FF+ AS S Sbjct: 62 DHALLKSVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNPKTALNFFYFASDS 121 Query: 129 FQFRFTMRSYC 97 FRFT+RSYC Sbjct: 122 CGFRFTLRSYC 132 >emb|CBI29222.3| unnamed protein product [Vitis vinifera] Length = 826 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/71 (59%), Positives = 51/71 (71%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 DH L K ++S+LS P LD + CK +IPHLS FD+ FFS+ NVNPKT L FF+ AS S Sbjct: 46 DHALLKSVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNPKTALNFFYFASDS 105 Query: 129 FQFRFTMRSYC 97 FRFT+RSYC Sbjct: 106 CGFRFTLRSYC 116 >ref|XP_009342743.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Pyrus x bretschneideri] Length = 835 Score = 91.3 bits (225), Expect = 3e-16 Identities = 43/71 (60%), Positives = 53/71 (74%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 D LH +SS+LSKP LD S CK+++P LS FD F SI SNVNPKT L FF+ AS+S Sbjct: 55 DQTLHNWVSSILSKPSLDSSKCKALVPLLSPLQFDQLFCSISSNVNPKTALHFFYFASES 114 Query: 129 FQFRFTMRSYC 97 F+FRFT+RS+C Sbjct: 115 FKFRFTVRSFC 125 >ref|XP_007217153.1| hypothetical protein PRUPE_ppa001463mg [Prunus persica] gi|462413303|gb|EMJ18352.1| hypothetical protein PRUPE_ppa001463mg [Prunus persica] Length = 821 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/71 (59%), Positives = 55/71 (77%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + LH +SS+LSKP LD S CK++IP LS+ +FD F SI SNVNPKT L FF+ AS+S Sbjct: 50 NQSLHNWVSSILSKPSLDSSKCKALIPLLSSHEFDRVFCSISSNVNPKTALHFFYFASES 109 Query: 129 FQFRFTMRSYC 97 F+F+FT+RS+C Sbjct: 110 FKFQFTVRSFC 120 >ref|XP_009338802.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Pyrus x bretschneideri] gi|694421948|ref|XP_009338803.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Pyrus x bretschneideri] gi|694421950|ref|XP_009338804.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Pyrus x bretschneideri] Length = 835 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/71 (61%), Positives = 52/71 (73%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 D LH +SSVLSKP LD S CK+++P LS FD F SI SNVNPKT L FF+ AS+S Sbjct: 55 DQSLHNWVSSVLSKPSLDSSKCKALVPLLSPLQFDQLFRSISSNVNPKTALHFFYFASES 114 Query: 129 FQFRFTMRSYC 97 F+FRFT+RS C Sbjct: 115 FKFRFTVRSLC 125 >ref|XP_008227937.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Prunus mume] Length = 834 Score = 90.5 bits (223), Expect = 4e-16 Identities = 42/71 (59%), Positives = 55/71 (77%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + LH +SS+LSKP LD S CK++IP LS+++FD F SI SNVNPKT L FF+ AS+S Sbjct: 54 NQSLHNWVSSILSKPSLDSSKCKALIPLLSSQEFDRVFCSISSNVNPKTALHFFYFASES 113 Query: 129 FQFRFTMRSYC 97 F+F+FT RS+C Sbjct: 114 FKFQFTARSFC 124 >gb|KDO46397.1| hypothetical protein CISIN_1g003295mg [Citrus sinensis] Length = 833 Score = 89.4 bits (220), Expect = 1e-15 Identities = 49/101 (48%), Positives = 60/101 (59%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + L K +SSVLSK LD S CK +P+LS ++FD FFSI SNVNPKT L+FF+ ASQS Sbjct: 51 NQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQS 110 Query: 129 FQFRFTMRSYCXXXXXXXXXXXXXXXXXXXXXLVDGKVNTL 7 FRFT+RSYC L+DGK+ L Sbjct: 111 CNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVL 151 >ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] gi|568835123|ref|XP_006471629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Citrus sinensis] gi|568835125|ref|XP_006471630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Citrus sinensis] gi|557534991|gb|ESR46109.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] Length = 833 Score = 89.4 bits (220), Expect = 1e-15 Identities = 49/101 (48%), Positives = 60/101 (59%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + L K +SSVLSK LD S CK +P+LS ++FD FFSI SNVNPKT L+FF+ ASQS Sbjct: 51 NQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYFASQS 110 Query: 129 FQFRFTMRSYCXXXXXXXXXXXXXXXXXXXXXLVDGKVNTL 7 FRFT+RSYC L+DGK+ L Sbjct: 111 CNFRFTVRSYCLLIRLLLFSNLLSPARLLLIRLIDGKMPVL 151 >ref|XP_007040906.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590680604|ref|XP_007040907.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590680608|ref|XP_007040908.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590680612|ref|XP_007040909.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590680616|ref|XP_007040910.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590680620|ref|XP_007040911.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778151|gb|EOY25407.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778152|gb|EOY25408.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778153|gb|EOY25409.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778154|gb|EOY25410.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778155|gb|EOY25411.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778156|gb|EOY25412.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 845 Score = 85.9 bits (211), Expect = 1e-14 Identities = 42/71 (59%), Positives = 52/71 (73%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + GL LS +LSK LD S CK ++P LS DFD FF +I S++NPKT L FF++ASQS Sbjct: 64 NQGLLGRLSCILSKSSLDSSKCKQLLPLLSPLDFDRFFSAISSHLNPKTTLHFFYLASQS 123 Query: 129 FQFRFTMRSYC 97 F FRFT+RSYC Sbjct: 124 FNFRFTLRSYC 134 >ref|XP_002303480.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550342907|gb|EEE78459.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 842 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/98 (42%), Positives = 57/98 (58%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 + L K +S +LS P LD + CK ++PHLS ++FD+ F ++ SNVNPKT L FFH S++ Sbjct: 60 NQSLLKRVSLILSNPSLDCAKCKELVPHLSPQEFDSCFLALKSNVNPKTALNFFHFVSET 119 Query: 129 FQFRFTMRSYCXXXXXXXXXXXXXXXXXXXXXLVDGKV 16 +FRFT RSYC L+DGKV Sbjct: 120 CKFRFTARSYCVLIHLLVGNDLLSPARLLLIRLIDGKV 157 >ref|XP_011027990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Populus euphratica] gi|743847504|ref|XP_011027991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Populus euphratica] gi|743847510|ref|XP_011027992.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Populus euphratica] Length = 839 Score = 83.6 bits (205), Expect = 5e-14 Identities = 40/93 (43%), Positives = 55/93 (59%) Frame = -3 Query: 294 KLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQFRF 115 K +S +LS P LD + CK ++PHLS+++FD+ F ++ SN NPKT L FFH S++ +FRF Sbjct: 62 KRVSLILSNPSLDRAKCKELVPHLSSQEFDSCFLALKSNANPKTALNFFHFVSETCKFRF 121 Query: 114 TMRSYCXXXXXXXXXXXXXXXXXXXXXLVDGKV 16 T RSYC L+DGKV Sbjct: 122 TARSYCVLIHLLVGNDLLSPARLLLIRLIDGKV 154 >ref|XP_012466482.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Gossypium raimondii] gi|763817666|gb|KJB84450.1| hypothetical protein B456_N026600 [Gossypium raimondii] Length = 846 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/64 (59%), Positives = 47/64 (73%) Frame = -3 Query: 288 LSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQFRFTM 109 LSS+LSKP LD S K ++P LS DFD FF ++ +PKT L FFH+AS+SF FRFT+ Sbjct: 83 LSSILSKPSLDSSKSKQLLPLLSPSDFDRFFIALSPRADPKTTLNFFHLASRSFNFRFTL 142 Query: 108 RSYC 97 RSYC Sbjct: 143 RSYC 146 >gb|KHG16388.1| hypothetical protein F383_21662 [Gossypium arboreum] Length = 794 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/64 (59%), Positives = 47/64 (73%) Frame = -3 Query: 288 LSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQFRFTM 109 LSS+LSKP LD S K ++P LS DFD FF ++ +PKT L FFH+AS+SF FRFT+ Sbjct: 60 LSSILSKPSLDSSKSKQLLPLLSPADFDRFFIALSPRADPKTTLNFFHLASRSFNFRFTL 119 Query: 108 RSYC 97 RSYC Sbjct: 120 RSYC 123 >sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g19440, chloroplastic; Flags: Precursor Length = 838 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/71 (56%), Positives = 46/71 (64%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 D LH+ LSSVLSK LDY CK +I LS +FD F S VNPKT L FF +AS S Sbjct: 73 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 132 Query: 129 FQFRFTMRSYC 97 F F F++RSYC Sbjct: 133 FSFSFSLRSYC 143 >emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|7268739|emb|CAB78946.1| putative protein [Arabidopsis thaliana] Length = 814 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/71 (56%), Positives = 46/71 (64%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 D LH+ LSSVLSK LDY CK +I LS +FD F S VNPKT L FF +AS S Sbjct: 49 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 108 Query: 129 FQFRFTMRSYC 97 F F F++RSYC Sbjct: 109 FSFSFSLRSYC 119 >ref|NP_567587.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186696|ref|NP_001190771.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|15810161|gb|AAL07224.1| unknown protein [Arabidopsis thaliana] gi|332658782|gb|AEE84182.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658783|gb|AEE84183.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 825 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/71 (56%), Positives = 46/71 (64%) Frame = -3 Query: 309 DHGLHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQS 130 D LH+ LSSVLSK LDY CK +I LS +FD F S VNPKT L FF +AS S Sbjct: 60 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 119 Query: 129 FQFRFTMRSYC 97 F F F++RSYC Sbjct: 120 FSFSFSLRSYC 130 >gb|KGN53456.1| hypothetical protein Csa_4G055990 [Cucumis sativus] Length = 710 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/68 (55%), Positives = 45/68 (66%) Frame = -3 Query: 300 LHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQF 121 LH +SSVLS LD S C +++PHLS FD FFSI NP T L FF+ AS SF+F Sbjct: 46 LHLWVSSVLSHSSLDSSKCSALLPHLSPSQFDQLFFSIGLKANPMTCLNFFYFASNSFKF 105 Query: 120 RFTMRSYC 97 RFT+ SYC Sbjct: 106 RFTIHSYC 113 >ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Cucumis sativus] gi|778691174|ref|XP_011653231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Cucumis sativus] gi|778691177|ref|XP_011653232.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Cucumis sativus] gi|778691180|ref|XP_011653233.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Cucumis sativus] gi|778691186|ref|XP_011653234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Cucumis sativus] Length = 822 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/68 (55%), Positives = 45/68 (66%) Frame = -3 Query: 300 LHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQF 121 LH +SSVLS LD S C +++PHLS FD FFSI NP T L FF+ AS SF+F Sbjct: 46 LHLWVSSVLSHSSLDSSKCSALLPHLSPSQFDQLFFSIGLKANPMTCLNFFYFASNSFKF 105 Query: 120 RFTMRSYC 97 RFT+ SYC Sbjct: 106 RFTIHSYC 113 >ref|XP_010449354.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Camelina sativa] gi|727554224|ref|XP_010449355.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Camelina sativa] Length = 840 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/68 (57%), Positives = 45/68 (66%) Frame = -3 Query: 300 LHKLLSSVLSKPYLDYSNCKSIIPHLSARDFDAFFFSIWSNVNPKTGLQFFHIASQSFQF 121 LH+ LSSVLSK LDY CK +I LS +FD F S VNPKT L FF +AS SF F Sbjct: 75 LHQRLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDSFSF 134 Query: 120 RFTMRSYC 97 F++RSYC Sbjct: 135 SFSLRSYC 142