BLASTX nr result
ID: Ziziphus21_contig00012774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00012774 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008376763.1| PREDICTED: acyl-CoA-binding domain-containin... 62 1e-07 ref|XP_008376761.1| PREDICTED: acyl-CoA-binding domain-containin... 62 1e-07 ref|XP_009351975.1| PREDICTED: acyl-CoA-binding domain-containin... 62 2e-07 ref|XP_008234703.1| PREDICTED: acyl-CoA-binding domain-containin... 61 4e-07 ref|XP_008234702.1| PREDICTED: acyl-CoA-binding domain-containin... 61 4e-07 ref|XP_007218227.1| hypothetical protein PRUPE_ppa007917mg [Prun... 61 4e-07 ref|XP_007218226.1| hypothetical protein PRUPE_ppa007917mg [Prun... 61 4e-07 ref|XP_008381106.1| PREDICTED: acyl-CoA-binding domain-containin... 60 8e-07 ref|XP_006491988.1| PREDICTED: acyl-CoA-binding domain-containin... 58 2e-06 ref|XP_006491987.1| PREDICTED: acyl-CoA-binding domain-containin... 58 2e-06 ref|XP_006441148.1| hypothetical protein CICLE_v10020753mg [Citr... 58 2e-06 ref|XP_006441147.1| hypothetical protein CICLE_v10020753mg [Citr... 58 2e-06 ref|XP_012486556.1| PREDICTED: acyl-CoA-binding domain-containin... 57 4e-06 ref|XP_012477558.1| PREDICTED: acyl-CoA-binding domain-containin... 57 5e-06 gb|KHG17093.1| Acyl-CoA-binding domain-containing 2 -like protei... 57 5e-06 ref|XP_012483219.1| PREDICTED: acyl-CoA-binding domain-containin... 56 9e-06 >ref|XP_008376763.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like isoform X2 [Malus domestica] Length = 357 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADTS KDNDGN+PC +C+SNWPW Q Sbjct: 321 LVKQNADTSAKDNDGNSPCDVCESNWPWFQ 350 >ref|XP_008376761.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like isoform X1 [Malus domestica] Length = 358 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADTS KDNDGN+PC +C+SNWPW Q Sbjct: 322 LVKQNADTSAKDNDGNSPCDVCESNWPWFQ 351 >ref|XP_009351975.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Pyrus x bretschneideri] Length = 357 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADTS KDNDGN+PC +C+S+WPW+Q Sbjct: 321 LVKQNADTSAKDNDGNSPCDICESDWPWLQ 350 >ref|XP_008234703.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like isoform X2 [Prunus mume] Length = 350 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADT KDNDG++PC LC+SNWPW+Q Sbjct: 317 LVKQNADTGAKDNDGSSPCDLCESNWPWLQ 346 >ref|XP_008234702.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like isoform X1 [Prunus mume] Length = 351 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADT KDNDG++PC LC+SNWPW+Q Sbjct: 318 LVKQNADTGAKDNDGSSPCDLCESNWPWLQ 347 >ref|XP_007218227.1| hypothetical protein PRUPE_ppa007917mg [Prunus persica] gi|462414689|gb|EMJ19426.1| hypothetical protein PRUPE_ppa007917mg [Prunus persica] Length = 351 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADT KDNDG++PC LC+SNWPW+Q Sbjct: 318 LVKQNADTGAKDNDGSSPCDLCESNWPWLQ 347 >ref|XP_007218226.1| hypothetical protein PRUPE_ppa007917mg [Prunus persica] gi|462414688|gb|EMJ19425.1| hypothetical protein PRUPE_ppa007917mg [Prunus persica] Length = 350 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADT KDNDG++PC LC+SNWPW+Q Sbjct: 317 LVKQNADTGAKDNDGSSPCDLCESNWPWLQ 346 >ref|XP_008381106.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Malus domestica] Length = 357 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQ 312 LVKQNADTS KDNDGN+P +C+SNWPW+Q Sbjct: 321 LVKQNADTSAKDNDGNSPSDICESNWPWLQ 350 >ref|XP_006491988.1| PREDICTED: acyl-CoA-binding domain-containing protein 2-like isoform X2 [Citrus sinensis] Length = 362 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK*ID 291 LVKQNAD +KDNDGN+PC +C+S+WPWM ++K D Sbjct: 326 LVKQNADIGMKDNDGNSPCHVCESDWPWMLHAAKGTD 362 >ref|XP_006491987.1| PREDICTED: acyl-CoA-binding domain-containing protein 2-like isoform X1 [Citrus sinensis] Length = 363 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK*ID 291 LVKQNAD +KDNDGN+PC +C+S+WPWM ++K D Sbjct: 327 LVKQNADIGMKDNDGNSPCHVCESDWPWMLHAAKGTD 363 >ref|XP_006441148.1| hypothetical protein CICLE_v10020753mg [Citrus clementina] gi|557543410|gb|ESR54388.1| hypothetical protein CICLE_v10020753mg [Citrus clementina] gi|641840708|gb|KDO59626.1| hypothetical protein CISIN_1g043342mg [Citrus sinensis] Length = 363 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK*ID 291 LVKQNAD +KDNDGN+PC +C+S+WPWM ++K D Sbjct: 327 LVKQNADIGMKDNDGNSPCHVCESDWPWMLHAAKGTD 363 >ref|XP_006441147.1| hypothetical protein CICLE_v10020753mg [Citrus clementina] gi|557543409|gb|ESR54387.1| hypothetical protein CICLE_v10020753mg [Citrus clementina] Length = 362 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK*ID 291 LVKQNAD +KDNDGN+PC +C+S+WPWM ++K D Sbjct: 326 LVKQNADIGMKDNDGNSPCHVCESDWPWMLHAAKGTD 362 >ref|XP_012486556.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Gossypium raimondii] gi|763770158|gb|KJB37373.1| hypothetical protein B456_006G202200 [Gossypium raimondii] Length = 367 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK 300 LVKQNAD KDNDGN+P LCDS+WPW+Q + K Sbjct: 332 LVKQNADKDTKDNDGNSPVDLCDSDWPWLQRAGK 365 >ref|XP_012477558.1| PREDICTED: acyl-CoA-binding domain-containing protein 2-like [Gossypium raimondii] Length = 101 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK 300 LVKQNAD KDNDGN+P LCDS+WPW+Q + K Sbjct: 59 LVKQNADKDSKDNDGNSPVDLCDSDWPWLQHAGK 92 >gb|KHG17093.1| Acyl-CoA-binding domain-containing 2 -like protein [Gossypium arboreum] Length = 368 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK 300 LVKQNAD KDNDGN+P LCDS WPW+Q + K Sbjct: 333 LVKQNADKDTKDNDGNSPVDLCDSGWPWLQRAGK 366 >ref|XP_012483219.1| PREDICTED: acyl-CoA-binding domain-containing protein 2-like [Gossypium raimondii] gi|763767261|gb|KJB34476.1| hypothetical protein B456_006G067800 [Gossypium raimondii] Length = 120 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -1 Query: 401 LVKQNADTSVKDNDGNTPCGLCDSNWPWMQWSSK 300 LVKQNA+ KDNDGN+P LCDS+WPW+Q + K Sbjct: 85 LVKQNAEKDTKDNDGNSPVDLCDSDWPWLQHAGK 118