BLASTX nr result
ID: Ziziphus21_contig00011429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011429 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112124.1| DNA topoisomerase 1 [Morus notabilis] gi|587... 57 5e-06 >ref|XP_010112124.1| DNA topoisomerase 1 [Morus notabilis] gi|587946410|gb|EXC32749.1| DNA topoisomerase 1 [Morus notabilis] Length = 1163 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/59 (47%), Positives = 36/59 (61%) Frame = -1 Query: 197 QPRPFMAKLQGRALNNYPGTCLSCSTFGTGNKHRTCSLLKYRKVRSCSMIMTNDAKFGK 21 Q R F AKLQ RAL+NY GTCL CS+FG NK R +L++++ + T K GK Sbjct: 26 QVRSFTAKLQLRALHNYTGTCLPCSSFGASNKCRKSALIRFKNKSFPCTLRTEHTKVGK 84