BLASTX nr result
ID: Ziziphus21_contig00010903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010903 (668 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO67836.1| hypothetical protein CISIN_1g041503mg [Citrus sin... 43 2e-06 >gb|KDO67836.1| hypothetical protein CISIN_1g041503mg [Citrus sinensis] Length = 99 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 15/48 (31%), Positives = 32/48 (66%) Frame = -3 Query: 222 CGKFIWAQDGEAKRDKIDILISEVRRLSVQVDKSNDMLEAIQKKTKRS 79 C F WA+D + +KID+L+ EVR+L++++++ +D + K+ + + Sbjct: 43 CKNFQWAEDRKFSNEKIDLLVEEVRKLTLEIERLSDKFRLLHKELEHT 90 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 19/40 (47%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = -1 Query: 443 MSTSTSDVQ-PIRMCS-CGQYMHLKTSRTDKNPNRQF*KC 330 MS+ST++ + +++C+ CG + L TS T KNPNR+F KC Sbjct: 1 MSSSTNESRNSLQVCNECGGQIELFTSHTTKNPNRKFWKC 40