BLASTX nr result
ID: Ziziphus21_contig00010822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010822 (450 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citr... 102 1e-19 ref|XP_012081781.1| PREDICTED: heavy metal-associated isoprenyla... 100 6e-19 ref|XP_011046678.1| PREDICTED: heavy metal-associated isoprenyla... 100 7e-19 ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa] g... 100 7e-19 ref|XP_011004609.1| PREDICTED: heavy metal-associated isoprenyla... 99 1e-18 ref|XP_010107664.1| hypothetical protein L484_008381 [Morus nota... 98 3e-18 ref|XP_002534419.1| metal ion binding protein, putative [Ricinus... 98 3e-18 ref|XP_002312958.2| hypothetical protein POPTR_0009s13760g [Popu... 97 4e-18 ref|XP_004144847.1| PREDICTED: heavy metal-associated isoprenyla... 97 4e-18 gb|ABK96034.1| unknown [Populus trichocarpa] 97 4e-18 ref|XP_011046131.1| PREDICTED: heavy metal-associated isoprenyla... 96 8e-18 ref|XP_008447957.1| PREDICTED: heavy metal-associated isoprenyla... 96 8e-18 ref|XP_014499703.1| PREDICTED: heavy metal-associated isoprenyla... 92 1e-16 gb|KOM42363.1| hypothetical protein LR48_Vigan04g256100 [Vigna a... 92 1e-16 gb|KHN33671.1| hypothetical protein glysoja_013677 [Glycine soja] 92 1e-16 ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenyla... 92 1e-16 ref|XP_007041824.1| Farnesylated protein 6 isoform 2 [Theobroma ... 92 2e-16 ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma ... 92 2e-16 ref|XP_004500726.1| PREDICTED: heavy metal-associated isoprenyla... 92 2e-16 ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phas... 92 2e-16 >ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citrus clementina] gi|568866801|ref|XP_006486737.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Citrus sinensis] gi|557524525|gb|ESR35831.1| hypothetical protein CICLE_v10029481mg [Citrus clementina] gi|641849198|gb|KDO68073.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis] gi|641849199|gb|KDO68074.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis] gi|641849200|gb|KDO68075.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis] Length = 154 Score = 102 bits (253), Expect = 1e-19 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTV+GY EPSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVV 78 >ref|XP_012081781.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Jatropha curcas] gi|643718447|gb|KDP29662.1| hypothetical protein JCGZ_18824 [Jatropha curcas] Length = 154 Score = 100 bits (248), Expect = 6e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVEIKVRIDCEGCERKVKRA+EGMKGVKQVDVERKANKVTV+GY +PSKVV Sbjct: 27 QTVEIKVRIDCEGCERKVKRALEGMKGVKQVDVERKANKVTVVGYVDPSKVV 78 >ref|XP_011046678.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Populus euphratica] gi|743906515|ref|XP_011046679.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Populus euphratica] Length = 154 Score = 99.8 bits (247), Expect = 7e-19 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKVKRA+EGMKGVKQVDVERKANKVTV+GY +PSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVERKANKVTVVGYVDPSKVV 78 >ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa] gi|222849149|gb|EEE86696.1| GMFP7 family protein [Populus trichocarpa] Length = 154 Score = 99.8 bits (247), Expect = 7e-19 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKVKRA+EGMKGVKQVDVERKANKVTV+GY +PSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVERKANKVTVVGYVDPSKVV 78 >ref|XP_011004609.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Populus euphratica] Length = 194 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +3 Query: 276 CDLYFDQTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 CD DQTVE+KVRIDCEGCERKV+RA+EGMKGVKQV VERKANKVTV+GY EPSKVV Sbjct: 64 CD---DQTVEVKVRIDCEGCERKVRRALEGMKGVKQVVVERKANKVTVVGYVEPSKVV 118 >ref|XP_010107664.1| hypothetical protein L484_008381 [Morus notabilis] gi|587929415|gb|EXC16575.1| hypothetical protein L484_008381 [Morus notabilis] Length = 154 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVR+DCEGCERKVKRA+EGMKGVKQVDVERKANKVTV+GY +P+KVV Sbjct: 27 QTVEVKVRLDCEGCERKVKRALEGMKGVKQVDVERKANKVTVVGYVDPAKVV 78 >ref|XP_002534419.1| metal ion binding protein, putative [Ricinus communis] gi|223525324|gb|EEF27963.1| metal ion binding protein, putative [Ricinus communis] Length = 154 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDV+RK+NK+TV+GY +PSKVV Sbjct: 27 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVDRKSNKLTVVGYVDPSKVV 78 >ref|XP_002312958.2| hypothetical protein POPTR_0009s13760g [Populus trichocarpa] gi|550331671|gb|EEE86913.2| hypothetical protein POPTR_0009s13760g [Populus trichocarpa] Length = 159 Score = 97.4 bits (241), Expect = 4e-18 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKVKRA+EGMKGVKQV VERKANKVTV+GY EPSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVKRALEGMKGVKQVVVERKANKVTVVGYVEPSKVV 78 >ref|XP_004144847.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis sativus] gi|700188019|gb|KGN43252.1| hypothetical protein Csa_7G012410 [Cucumis sativus] Length = 154 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+K+RIDCEGCERKVKRA+EGMKGVKQVDV+RKANK TV+GY EPSKVV Sbjct: 27 QTVELKIRIDCEGCERKVKRALEGMKGVKQVDVDRKANKATVVGYVEPSKVV 78 >gb|ABK96034.1| unknown [Populus trichocarpa] Length = 154 Score = 97.4 bits (241), Expect = 4e-18 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKVKRA+EGMKGVKQV VERKANKVTV+GY EPSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVKRALEGMKGVKQVVVERKANKVTVVGYVEPSKVV 78 >ref|XP_011046131.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Populus euphratica] Length = 154 Score = 96.3 bits (238), Expect = 8e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KVRIDCEGCERKV+RA+EGMKGVKQV VERKANKVTV+GY EPSKVV Sbjct: 27 QTVEVKVRIDCEGCERKVRRALEGMKGVKQVVVERKANKVTVVGYVEPSKVV 78 >ref|XP_008447957.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis melo] Length = 154 Score = 96.3 bits (238), Expect = 8e-18 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+K+RIDCEGCERKVKRA+EGMKGVKQVDV+RK+NK TV+GY EPSKVV Sbjct: 27 QTVELKIRIDCEGCERKVKRALEGMKGVKQVDVDRKSNKATVVGYVEPSKVV 78 >ref|XP_014499703.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Vigna radiata var. radiata] Length = 154 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKVK+AVEGMKGV QVDV+RKANKVTV+GY E SKVV Sbjct: 27 QTVEVKVKMDCEGCERKVKKAVEGMKGVNQVDVDRKANKVTVVGYVEASKVV 78 >gb|KOM42363.1| hypothetical protein LR48_Vigan04g256100 [Vigna angularis] Length = 154 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKVK+AVEGMKGV QVDV+RKANKVTV+GY E SKVV Sbjct: 27 QTVEVKVKMDCEGCERKVKKAVEGMKGVNQVDVDRKANKVTVVGYVEASKVV 78 >gb|KHN33671.1| hypothetical protein glysoja_013677 [Glycine soja] Length = 180 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKV++AVEGMKGV QVDVERKANKVTV+GY E SKVV Sbjct: 53 QTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVERKANKVTVVGYVEASKVV 104 >ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Glycine max] gi|947112395|gb|KRH60697.1| hypothetical protein GLYMA_04G003700 [Glycine max] gi|947112396|gb|KRH60698.1| hypothetical protein GLYMA_04G003700 [Glycine max] Length = 154 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKV++AVEGMKGV QVDVERKANKVTV+GY E SKVV Sbjct: 27 QTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVERKANKVTVVGYVEASKVV 78 >ref|XP_007041824.1| Farnesylated protein 6 isoform 2 [Theobroma cacao] gi|508705759|gb|EOX97655.1| Farnesylated protein 6 isoform 2 [Theobroma cacao] Length = 185 Score = 92.0 bits (227), Expect = 2e-16 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVEIKV++DCEGCERKVK++VEGMKGV QVDVERKANK+TV+GY +P+KVV Sbjct: 58 QTVEIKVKMDCEGCERKVKKSVEGMKGVTQVDVERKANKLTVVGYVDPAKVV 109 >ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] gi|508705758|gb|EOX97654.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] Length = 154 Score = 92.0 bits (227), Expect = 2e-16 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVEIKV++DCEGCERKVK++VEGMKGV QVDVERKANK+TV+GY +P+KVV Sbjct: 27 QTVEIKVKMDCEGCERKVKKSVEGMKGVTQVDVERKANKLTVVGYVDPAKVV 78 >ref|XP_004500726.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Cicer arietinum] Length = 154 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/52 (78%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKV++AVEGMKGV QVD++RKA+KVTV+GY EPSKVV Sbjct: 26 QTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDIDRKASKVTVVGYVEPSKVV 77 >ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris] gi|543176614|gb|AGV54330.1| metal ion binding protein [Phaseolus vulgaris] gi|561010432|gb|ESW09339.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris] Length = 154 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/52 (78%), Positives = 50/52 (96%) Frame = +3 Query: 294 QTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVIGYEEPSKVV 449 QTVE+KV++DCEGCERKV++AVEGMKGV QV+V+RKANKVTV+GY +PSKVV Sbjct: 27 QTVEVKVKMDCEGCERKVRKAVEGMKGVNQVEVDRKANKVTVVGYVDPSKVV 78