BLASTX nr result
ID: Ziziphus21_contig00010686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010686 (590 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106417.1| hypothetical protein L484_008623 [Morus nota... 64 7e-08 ref|XP_010106411.1| hypothetical protein L484_008616 [Morus nota... 62 3e-07 ref|XP_008465752.1| PREDICTED: protein EARLY RESPONSIVE TO DEHYD... 60 8e-07 ref|XP_004140285.1| PREDICTED: protein EARLY RESPONSIVE TO DEHYD... 60 1e-06 >ref|XP_010106417.1| hypothetical protein L484_008623 [Morus notabilis] gi|587923095|gb|EXC10456.1| hypothetical protein L484_008623 [Morus notabilis] Length = 178 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = -2 Query: 148 ITGLEMDARTILKDLTVTKSPKERGPRSPRGPAKYREKAVQYVSPKCSP 2 + GL+MDA+ ILK LTV KS ER P SP GPAKYREK + VSPK +P Sbjct: 123 LNGLKMDAKAILKSLTVPKSANERCPVSPAGPAKYREKPTKNVSPKSTP 171 >ref|XP_010106411.1| hypothetical protein L484_008616 [Morus notabilis] gi|587923089|gb|EXC10450.1| hypothetical protein L484_008616 [Morus notabilis] Length = 178 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 148 ITGLEMDARTILKDLTVTKSPKERGPRSPRGPAKYREKAVQYVSPK 11 + GL+MDA+ ILK LT+ KS ER P SP GPAKYREK + VSPK Sbjct: 123 LNGLKMDAKAILKSLTIPKSANERRPMSPAGPAKYREKPTKNVSPK 168 >ref|XP_008465752.1| PREDICTED: protein EARLY RESPONSIVE TO DEHYDRATION 15-like [Cucumis melo] Length = 150 Score = 60.1 bits (144), Expect = 8e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -2 Query: 136 EMDARTILKDLTVTKSPKERGPRSPRGPAKYREKAVQYVSPKCSP 2 EMDA+ +LKDL + SPK +GP+SP GPAKY EK + +SPK +P Sbjct: 99 EMDAKKLLKDLVIPNSPKNKGPKSPIGPAKYNEKPAKCMSPKHTP 143 >ref|XP_004140285.1| PREDICTED: protein EARLY RESPONSIVE TO DEHYDRATION 15-like [Cucumis sativus] gi|700195923|gb|KGN51100.1| hypothetical protein Csa_5G440140 [Cucumis sativus] Length = 150 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -2 Query: 136 EMDARTILKDLTVTKSPKERGPRSPRGPAKYREKAVQYVSPKCSP 2 EMDA+ +LKDL + SPK +GP+SP GPAKY EK + +SPK +P Sbjct: 99 EMDAKKLLKDLVIPNSPKNKGPKSPIGPAKYSEKPAKCMSPKHTP 143