BLASTX nr result
ID: Ziziphus21_contig00010555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010555 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 116 6e-24 ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containi... 110 5e-22 ref|XP_008350544.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 103 5e-20 ref|XP_007206864.1| hypothetical protein PRUPE_ppa1027201mg, par... 103 6e-20 ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 100 4e-19 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 97 4e-18 gb|KOM58419.1| hypothetical protein LR48_Vigan11g145300 [Vigna a... 96 1e-17 ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein... 96 1e-17 emb|CDP04793.1| unnamed protein product [Coffea canephora] 90 6e-16 ref|XP_014515022.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-15 ref|XP_002309609.2| pentatricopeptide repeat-containing family p... 86 8e-15 ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [C... 85 2e-14 ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citr... 85 2e-14 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 116 bits (291), Expect = 6e-24 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 1/84 (1%) Frame = -1 Query: 251 DFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARN 72 D T A+VINTLLSH++DP SA YFKWAE+MRGF++ +D F VLLH+LMGS +THG+A++ Sbjct: 83 DLTQAHVINTLLSHKNDPYSALKYFKWAERMRGFIRGVDSFSVLLHILMGSQETHGSAQS 142 Query: 71 LLNQYVSSDSGPSL-VFVHNLVDC 3 LL+ YVS DSGPS VFV +L DC Sbjct: 143 LLSLYVSGDSGPSANVFVDHLFDC 166 >ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39230, mitochondrial-like [Malus domestica] Length = 860 Score = 111 bits (277), Expect = 2e-22 Identities = 54/87 (62%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D + T +VI+TLLSH+S P SA YFKWAE+ RG V+ +D CVLLH+LMGSP+TH Sbjct: 84 QDSELTQTSVISTLLSHKSKPYSAIKYFKWAERERGLVRGVDAVCVLLHILMGSPNTHER 143 Query: 80 ARNLLNQYVSSDSGP-SLVFVHNLVDC 3 A+ LLNQYVS DSGP VFV +LVDC Sbjct: 144 AKMLLNQYVSGDSGPVPGVFVDHLVDC 170 >ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Pyrus x bretschneideri] gi|694405904|ref|XP_009377787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 860 Score = 110 bits (274), Expect = 5e-22 Identities = 54/87 (62%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D + T +VI+TLLSH+S P SA YFKWAE+ RGFV+ +D CVLLH+LMGSP+T Sbjct: 84 QDSELTQTSVISTLLSHKSKPYSAVKYFKWAERERGFVRGVDAVCVLLHILMGSPNTQER 143 Query: 80 ARNLLNQYVSSDSGP-SLVFVHNLVDC 3 A+ LLNQYVS DSGP VFV +LVDC Sbjct: 144 AKMLLNQYVSGDSGPVPGVFVDHLVDC 170 >ref|XP_008350544.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Malus domestica] Length = 835 Score = 103 bits (257), Expect = 5e-20 Identities = 49/86 (56%), Positives = 62/86 (72%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D + T +VI+TLLSH+ P SA YFKW E+ RGFV+ +D CVLLH+LMG+P TH Sbjct: 54 EDSELTQTSVISTLLSHKXKPNSAVNYFKWXERERGFVRGVDAXCVLLHILMGNPKTHXR 113 Query: 80 ARNLLNQYVSSDSGPSLVFVHNLVDC 3 A+ LLNQYVS +SG FV +LVDC Sbjct: 114 AKMLLNQYVSGNSG---XFVXHLVDC 136 >ref|XP_007206864.1| hypothetical protein PRUPE_ppa1027201mg, partial [Prunus persica] gi|462402506|gb|EMJ08063.1| hypothetical protein PRUPE_ppa1027201mg, partial [Prunus persica] Length = 782 Score = 103 bits (256), Expect = 6e-20 Identities = 51/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%) Frame = -1 Query: 251 DFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARN 72 + T VI+TLLSHRS+P SA +F WAEK RGF+K +D FCVLLH+L G +TH A+ Sbjct: 2 ELTQTKVISTLLSHRSEPNSALKHFIWAEKERGFLKGVDAFCVLLHILTGFEETHVRAQI 61 Query: 71 LLNQYVSSDSGPS-LVFVHNLVDC 3 LLNQY S DSGPS VF LVDC Sbjct: 62 LLNQYASGDSGPSQQVFFDRLVDC 85 >ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Prunus mume] Length = 859 Score = 101 bits (251), Expect = 2e-19 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 1/87 (1%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D + T VI+TLLSHRS+P SA +F WAEK RGF+K +D FCVLLH+L +TH Sbjct: 76 RDSEITQTKVISTLLSHRSEPNSALEHFIWAEKERGFLKGVDAFCVLLHILTRFEETHVR 135 Query: 80 ARNLLNQYVSSDSGPS-LVFVHNLVDC 3 A+ LLNQY S DSGP+ VF L+DC Sbjct: 136 AQILLNQYASGDSGPAQQVFFDRLIDC 162 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 100 bits (249), Expect = 4e-19 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 1/79 (1%) Frame = -1 Query: 236 NVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQY 57 +VI+ LL H +DP+SA YFK AE RGF++ +D +CVLLH+LM SP+THG AR LLN+Y Sbjct: 429 HVIDALLCHVNDPQSALRYFKRAETQRGFIRGVDAYCVLLHILMRSPETHGHARKLLNRY 488 Query: 56 VSSDSGPS-LVFVHNLVDC 3 VS DS PS +VFV +L++C Sbjct: 489 VSGDSDPSPVVFVDHLINC 507 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 100 bits (249), Expect = 4e-19 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 1/79 (1%) Frame = -1 Query: 236 NVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQY 57 +VI+ LL H +DP+SA YFK AE RGF++ +D +CVLLH+LM SP+THG AR LLN+Y Sbjct: 62 HVIDALLCHVNDPQSALRYFKRAETQRGFIRGVDAYCVLLHILMRSPETHGHARKLLNRY 121 Query: 56 VSSDSGPS-LVFVHNLVDC 3 VS DS PS +VFV +L++C Sbjct: 122 VSGDSDPSPVVFVDHLINC 140 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 100 bits (249), Expect = 4e-19 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 1/79 (1%) Frame = -1 Query: 236 NVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQY 57 +VI+ LL H +DP+SA YFK AE RGF++ +D +CVLLH+LM SP+THG AR LLN+Y Sbjct: 102 HVIDALLCHVNDPQSALRYFKRAETQRGFIRGVDAYCVLLHILMRSPETHGHARKLLNRY 161 Query: 56 VSSDSGPS-LVFVHNLVDC 3 VS DS PS +VFV +L++C Sbjct: 162 VSGDSDPSPVVFVDHLINC 180 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttatus] Length = 849 Score = 97.4 bits (241), Expect = 4e-18 Identities = 51/81 (62%), Positives = 61/81 (75%), Gaps = 2/81 (2%) Frame = -1 Query: 239 ANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI-DVFCVLLHVLMGSPDTHGAARNLLN 63 ANV+ TLLS+ +DPRSA YF+WAEK RGFV+ I D F VLLH+L+ S HG+ARNLLN Sbjct: 72 ANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFLVLLHILVSSHYHHGSARNLLN 131 Query: 62 QYVSSDSGPS-LVFVHNLVDC 3 Y+SSDS PS V V L+DC Sbjct: 132 NYLSSDSAPSGGVLVQRLIDC 152 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 97.4 bits (241), Expect = 4e-18 Identities = 51/81 (62%), Positives = 61/81 (75%), Gaps = 2/81 (2%) Frame = -1 Query: 239 ANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI-DVFCVLLHVLMGSPDTHGAARNLLN 63 ANV+ TLLS+ +DPRSA YF+WAEK RGFV+ I D F VLLH+L+ S HG+ARNLLN Sbjct: 72 ANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFLVLLHILVSSHYHHGSARNLLN 131 Query: 62 QYVSSDSGPS-LVFVHNLVDC 3 Y+SSDS PS V V L+DC Sbjct: 132 NYLSSDSAPSGGVLVQRLIDC 152 >gb|KOM58419.1| hypothetical protein LR48_Vigan11g145300 [Vigna angularis] Length = 837 Score = 95.9 bits (237), Expect = 1e-17 Identities = 45/78 (57%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 233 VINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQYV 54 V++TLL H++DPRSA +FK E+ RGF+K +DV C+LLH+L SPDTHG A+ LLN YV Sbjct: 65 VLDTLLLHKADPRSALVFFKKVERQRGFLKTVDVLCLLLHILCSSPDTHGDAKYLLNNYV 124 Query: 53 SSDSGPS-LVFVHNLVDC 3 DS PS V V +LV+C Sbjct: 125 FGDSAPSPKVLVEHLVEC 142 >ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784178|gb|EOY31434.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1159 Score = 95.9 bits (237), Expect = 1e-17 Identities = 45/86 (52%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D T +VINTLL HR++P SA YF++ E RGFV++IDVFCVLLH+L+GS T+ Sbjct: 377 QDTSLTRTHVINTLLIHRNNPESALKYFRFVENKRGFVRSIDVFCVLLHILVGSQQTNKQ 436 Query: 80 ARNLLNQYVSSDSGPS-LVFVHNLVD 6 + LLN++V+ DSGP+ +VF+ +L+D Sbjct: 437 VKYLLNRFVAGDSGPTPIVFLDHLID 462 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 90.1 bits (222), Expect = 6e-16 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 3/81 (3%) Frame = -1 Query: 236 NVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI-DVFCVLLHVLMGSPDTHGAARNLLNQ 60 +V+ +LLSHR+DP +AF YF+WAE RGF++ + D +CVLLH+L+ SP+ + R LLN Sbjct: 80 HVVESLLSHRNDPAAAFKYFQWAEGQRGFLRGVSDPYCVLLHILVSSPNEYSLTRRLLNS 139 Query: 59 YVSSDSGPS--LVFVHNLVDC 3 YVSSDS PS L+F H L+ C Sbjct: 140 YVSSDSSPSGILLFDH-LISC 159 >ref|XP_014515022.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Vigna radiata var. radiata] Length = 837 Score = 89.4 bits (220), Expect = 1e-15 Identities = 42/78 (53%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = -1 Query: 233 VINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQYV 54 V++TLL H++DPRSA +FK E+ RGF+K +DV C+LL +L SP THG A+ LN YV Sbjct: 65 VLDTLLLHKADPRSALVFFKKVERQRGFLKTVDVLCLLLQILCSSPSTHGDAKYFLNNYV 124 Query: 53 SSDSGPSL-VFVHNLVDC 3 DS PS V V +LV+C Sbjct: 125 LGDSAPSAKVLVEHLVEC 142 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 1/78 (1%) Frame = -1 Query: 233 VINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARNLLNQYV 54 +++TLL+H+S+P+SA +FK E+ RGFVK +DVF +LL +L +P TH + RNLLN YV Sbjct: 79 ILDTLLTHKSNPKSALKFFKGVERKRGFVKTVDVFSLLLQILSSTPQTHSSLRNLLNNYV 138 Query: 53 SSDSGPS-LVFVHNLVDC 3 DS PS V V +L++C Sbjct: 139 FGDSSPSPKVLVEHLLEC 156 >ref|XP_002309609.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550337148|gb|EEE93132.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 841 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/75 (50%), Positives = 53/75 (70%) Frame = -1 Query: 260 KDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGA 81 +D T I+TLL+H++DP+SA +YF WA + RG +K++D CVLLH+L S +T G Sbjct: 58 QDSFLTQTQYIDTLLNHQNDPQSALSYFTWASQKRGLIKSVDALCVLLHILTKSTETCGK 117 Query: 80 ARNLLNQYVSSDSGP 36 ARNLLN++ S D GP Sbjct: 118 ARNLLNRFASDDWGP 132 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 85.5 bits (210), Expect = 1e-14 Identities = 45/79 (56%), Positives = 57/79 (72%), Gaps = 2/79 (2%) Frame = -1 Query: 233 VINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI-DVFCVLLHVLMGSPDTHGAARNLLNQY 57 V++TLLSH +DP +A YF+ EK GFV+ I D F VLLH+L+ S D HGAARNLLN Y Sbjct: 84 VVDTLLSHINDPLAALEYFRSVEKQPGFVREIGDSFFVLLHILVSSRDHHGAARNLLNNY 143 Query: 56 VSSDSGPS-LVFVHNLVDC 3 +S DS PS +V V L++C Sbjct: 144 LSGDSAPSGVVLVDRLINC 162 >gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [Citrus sinensis] Length = 850 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -1 Query: 251 DFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARN 72 D + +VI++LLS R++P SAF YFK E+ RGF+K++D FCVLLH+LM ++H ARN Sbjct: 3 DLSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSLDTFCVLLHILMKDRESHRYARN 62 Query: 71 LLNQYVSSDSGP-SLVFVHNLVD 6 LLN YVS S P S + +L++ Sbjct: 63 LLNHYVSGGSEPTSAAIIDHLIE 85 >ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] gi|568859583|ref|XP_006483317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Citrus sinensis] gi|557553718|gb|ESR63732.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] Length = 850 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -1 Query: 251 DFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAIDVFCVLLHVLMGSPDTHGAARN 72 D + +VI++LLS R++P SAF YFK E+ RGF+K++D FCVLLH+LM ++H ARN Sbjct: 71 DLSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSLDTFCVLLHILMKDRESHRYARN 130 Query: 71 LLNQYVSSDSGP-SLVFVHNLVD 6 LLN YVS S P S + +L++ Sbjct: 131 LLNHYVSGGSEPTSAAIIDHLIE 153