BLASTX nr result
ID: Ziziphus21_contig00010501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010501 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR43577.1| reverse transcriptase, partial [Ziziphus jujuba] 87 5e-15 gb|ADF45764.1| reverse transcriptase, partial [Eleocharis acicul... 65 2e-08 gb|ADF45766.1| reverse transcriptase, partial [Eleocharis acicul... 63 1e-07 gb|AAB36247.1| retrotransposon peptide {Ty1-copia retrotransposo... 63 1e-07 gb|AKM12490.1| reverse transcriptase, partial [Polysphaeria parv... 62 1e-07 gb|AKM12487.1| reverse transcriptase, partial [Ixora sp. CMAC-2015] 62 1e-07 emb|CAH23479.1| reverse transcriptase [Solanum tuberosum] 62 2e-07 gb|AKM12489.1| reverse transcriptase, partial [Polysphaeria parv... 61 3e-07 gb|AKM12486.1| reverse transcriptase, partial [Ixora sp. CMAC-2015] 61 3e-07 gb|ADF45793.1| reverse transcriptase, partial [Eleocharis carnio... 61 3e-07 gb|AAG44322.1|AF232979_1 reverse transcriptase-like protein [Ama... 61 3e-07 gb|AKM12491.1| reverse transcriptase, partial [Coffea ebracteolata] 61 4e-07 gb|AKM12480.1| reverse transcriptase, partial [Coptosperma sp. C... 61 4e-07 gb|AKM12478.1| reverse transcriptase, partial [Coffea stenophyll... 61 4e-07 gb|AKM12473.1| reverse transcriptase, partial [Coffea eugenioides] 61 4e-07 gb|AKM12472.1| reverse transcriptase, partial [Coffea eugenioides] 61 4e-07 gb|ADF45939.1| reverse transcriptase, partial [Eleocharis palust... 61 4e-07 gb|ADF45866.1| reverse transcriptase, partial [Eleocharis ovata] 61 4e-07 gb|ADF45828.1| reverse transcriptase, partial [Eleocharis erythr... 61 4e-07 gb|AKM12481.1| reverse transcriptase, partial [Ixora coccinea] 60 5e-07 >gb|AFR43577.1| reverse transcriptase, partial [Ziziphus jujuba] Length = 90 Score = 87.0 bits (214), Expect = 5e-15 Identities = 45/62 (72%), Positives = 49/62 (79%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFKDTMT 64 E FEIKGK DLVCLLKKSLYGLKQSP+ WYK+ KS F +RSNFDSCLYFKD +T Sbjct: 18 EGFEIKGKVGDLVCLLKKSLYGLKQSPRQWYKRFYSFVVKSGF-QRSNFDSCLYFKDPVT 76 Query: 63 DK 58 DK Sbjct: 77 DK 78 >gb|ADF45764.1| reverse transcriptase, partial [Eleocharis acicularis] gi|294863611|gb|ADF45765.1| reverse transcriptase, partial [Eleocharis acicularis] Length = 88 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 E FE+ GK RD VCLLKKSLYGLKQSP+ WYKK F RSN+DSC+YFK Sbjct: 18 EGFEVVGK-RDHVCLLKKSLYGLKQSPRQWYKKFDSFMVSLNF-SRSNYDSCVYFK 71 >gb|ADF45766.1| reverse transcriptase, partial [Eleocharis acicularis] Length = 88 Score = 62.8 bits (151), Expect = 1e-07 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 E FE+ GK D CLLKKS+YGLKQSP+ WYKK F F RSN+DSC+YFK Sbjct: 18 EGFEVVGK-EDHGCLLKKSIYGLKQSPRQWYKKFDFFMVSLNF-SRSNYDSCVYFK 71 >gb|AAB36247.1| retrotransposon peptide {Ty1-copia retrotransposon element, clone Mel 10} [Vicia melanops, leaves, Peptide Transposon Partial, 75 aa] Length = 75 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFKDTM 67 E FE++ K +D VCLLKKSLYGLKQSP+ WYK+V ++ +C RS DSC+Y+K ++ Sbjct: 12 EGFEVQEK-KDHVCLLKKSLYGLKQSPRQWYKRVDTFMLENGYC-RSEHDSCVYYKKSL 68 >gb|AKM12490.1| reverse transcriptase, partial [Polysphaeria parvifolia] Length = 127 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G+++ RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGRNYL--RSMYDSCVYFR 105 >gb|AKM12487.1| reverse transcriptase, partial [Ixora sp. CMAC-2015] Length = 127 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ FI G+ + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFILGQGY--TRSMYDSCVYFR 105 >emb|CAH23479.1| reverse transcriptase [Solanum tuberosum] Length = 77 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/57 (59%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 E FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 12 EGFEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHGY--SRSMYDSCVYFR 65 >gb|AKM12489.1| reverse transcriptase, partial [Polysphaeria parvifolia] Length = 127 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G ++ RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHNY--SRSMYDSCVYFR 105 >gb|AKM12486.1| reverse transcriptase, partial [Ixora sp. CMAC-2015] Length = 127 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G+ + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGQGY--TRSMYDSCVYFR 105 >gb|ADF45793.1| reverse transcriptase, partial [Eleocharis carniolica] Length = 88 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/56 (60%), Positives = 38/56 (67%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 E FE+ GK D VCLLKKSLYGLKQSP+ WYK F RSN+DSC+YFK Sbjct: 18 EGFEVVGK-EDHVCLLKKSLYGLKQSPRQWYKNFDSFMVSLNF-SRSNYDSCVYFK 71 >gb|AAG44322.1|AF232979_1 reverse transcriptase-like protein [Amaranthus hybridus] Length = 95 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 ECFE+KGK VC LKKSLYGLKQSP+ WYKK F RS++DSC+Y K Sbjct: 23 ECFEVKGK-ESHVCRLKKSLYGLKQSPRQWYKKFDSFMLSHDF-TRSSYDSCVYLK 76 >gb|AKM12491.1| reverse transcriptase, partial [Coffea ebracteolata] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHGY--SRSMYDSCVYFR 105 >gb|AKM12480.1| reverse transcriptase, partial [Coptosperma sp. CMAC-2015] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYF 79 FEI+GK +D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF Sbjct: 54 FEIEGK-KDHVCLLKKSLYGLKQSPRQWYKRFDTFMLGHGY--SRSMYDSCVYF 104 >gb|AKM12478.1| reverse transcriptase, partial [Coffea stenophylla] gi|831250488|gb|AKM12479.1| reverse transcriptase, partial [Coffea stenophylla] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDFFMLGHGYL--RSMYDSCVYFR 105 >gb|AKM12473.1| reverse transcriptase, partial [Coffea eugenioides] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHGYL--RSMYDSCVYFR 105 >gb|AKM12472.1| reverse transcriptase, partial [Coffea eugenioides] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHGYL--RSMYDSCVYFR 105 >gb|ADF45939.1| reverse transcriptase, partial [Eleocharis palustris var. vigens] Length = 89 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 E F + GK D VCLLKKSLYGLKQSP+ WYKK F+ ++ RSN+DSC+YFK Sbjct: 18 EGFAVMGK-EDHVCLLKKSLYGLKQSPRQWYKKFDSFMISLNF--SRSNYDSCVYFK 71 >gb|ADF45866.1| reverse transcriptase, partial [Eleocharis ovata] Length = 89 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/56 (60%), Positives = 38/56 (67%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 E F + GK D VCLLKKSLYGLKQSP+ WYKK F RSN+DSC+YFK Sbjct: 18 EGFAVVGK-EDHVCLLKKSLYGLKQSPRQWYKKFDSFMVSLNF-SRSNYDSCVYFK 71 >gb|ADF45828.1| reverse transcriptase, partial [Eleocharis erythropoda] Length = 81 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/56 (60%), Positives = 38/56 (67%) Frame = -1 Query: 243 ECFEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV*FICGKSWFCERSNFDSCLYFK 76 E FE+ GK D VCLLKK LYGLKQSP+ WYKK F RSN+DSC+YFK Sbjct: 18 EGFEVVGK-EDHVCLLKKFLYGLKQSPRQWYKKFDSFMVSLNF-SRSNYDSCVYFK 71 >gb|AKM12481.1| reverse transcriptase, partial [Ixora coccinea] Length = 127 Score = 60.5 bits (145), Expect = 5e-07 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 237 FEIKGKGRDLVCLLKKSLYGLKQSPK*WYKKV-*FICGKSWFCERSNFDSCLYFK 76 FEI+GK D VCLLKKSLYGLKQSP+ WYK+ F+ G + RS +DSC+YF+ Sbjct: 54 FEIEGK-EDHVCLLKKSLYGLKQSPRQWYKRFDSFMLGHGY--TRSMYDSCVYFR 105