BLASTX nr result
ID: Ziziphus21_contig00009749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00009749 (234 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001280922.1| probable aquaporin PIP1-4 [Malus domestica] ... 91 4e-16 gb|AEY75243.1| plasma membrane intrinsic protein [Malus hupehensis] 91 4e-16 ref|XP_002526867.1| Aquaporin PIP1.3, putative [Ricinus communis... 89 1e-15 ref|XP_002526866.1| Aquaporin PIP1.3, putative [Ricinus communis... 89 1e-15 ref|XP_010095072.1| Aquaporin PIP1-1 [Morus notabilis] gi|587868... 89 1e-15 ref|XP_009344552.1| PREDICTED: probable aquaporin PIP1-4 [Pyrus ... 89 1e-15 ref|XP_004307619.1| PREDICTED: probable aquaporin PIP-type 7a [F... 88 2e-15 ref|NP_001274378.1| probable aquaporin PIP1-4-like [Cucumis sati... 88 3e-15 ref|XP_008463222.1| PREDICTED: probable aquaporin PIP1-4 [Cucumi... 88 3e-15 ref|NP_001267686.1| uncharacterized protein LOC101215145 [Cucumi... 88 3e-15 ref|NP_001280914.1| probable aquaporin PIP1-4 [Malus domestica] ... 87 4e-15 ref|XP_008233728.1| PREDICTED: probable aquaporin PIP1-4 [Prunus... 87 4e-15 ref|XP_007218768.1| hypothetical protein PRUPE_ppa009506mg [Prun... 87 4e-15 gb|ACR54285.1| aquaporin [Juglans regia] 87 4e-15 dbj|BAF62342.1| aquaporin [Prunus persica] 87 4e-15 dbj|BAF44223.1| aquaporin [Iris x hollandica] 87 6e-15 dbj|BAB40142.1| plasma membrane intrinsic protein 1-1 [Pyrus com... 86 8e-15 ref|XP_009350886.1| PREDICTED: probable aquaporin PIP1-4 [Pyrus ... 86 8e-15 ref|XP_007009059.1| Plasma membrane intrinsic protein 1,4 [Theob... 86 8e-15 gb|ABK60194.1| PIP1 protein [Gossypium hirsutum] gi|728851147|gb... 86 8e-15 >ref|NP_001280922.1| probable aquaporin PIP1-4 [Malus domestica] gi|46092502|dbj|BAD14371.1| plasma membrane intrinsic protein [Malus domestica] Length = 289 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANKY E QPIGT+AQSQDD KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKYSERQPIGTSAQSQDDGKDYKEPPPAPLFEPGE 47 >gb|AEY75243.1| plasma membrane intrinsic protein [Malus hupehensis] Length = 289 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANKY E QPIGT+AQSQDD KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKYSERQPIGTSAQSQDDGKDYKEPPPAPLFEPGE 47 >ref|XP_002526867.1| Aquaporin PIP1.3, putative [Ricinus communis] gi|38198152|emb|CAE53882.1| aquaporin [Ricinus communis] gi|223533766|gb|EEF35498.1| Aquaporin PIP1.3, putative [Ricinus communis] Length = 288 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANKYRETQPIGTAAQSQDD KDY EPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKYRETQPIGTAAQSQDD-KDYTEPPPAPLFEPGE 46 >ref|XP_002526866.1| Aquaporin PIP1.3, putative [Ricinus communis] gi|223533765|gb|EEF35497.1| Aquaporin PIP1.3, putative [Ricinus communis] Length = 287 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANKYRETQPIGTAAQSQDD KDY EPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKYRETQPIGTAAQSQDD-KDYTEPPPAPLFEPGE 46 >ref|XP_010095072.1| Aquaporin PIP1-1 [Morus notabilis] gi|587868843|gb|EXB58178.1| Aquaporin PIP1-1 [Morus notabilis] Length = 288 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQ+QDD KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKFSERQPIGTAAQTQDDGKDYKEPPPAPLFEPGE 47 >ref|XP_009344552.1| PREDICTED: probable aquaporin PIP1-4 [Pyrus x bretschneideri] gi|452891291|gb|AGG19164.1| plasma membrane intrinsic protein [Pyrus pyrifolia] Length = 289 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANKY E QPIGT+AQSQD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKYSERQPIGTSAQSQDEGKDYKEPPPAPLFEPGE 47 >ref|XP_004307619.1| PREDICTED: probable aquaporin PIP-type 7a [Fragaria vesca subsp. vesca] Length = 290 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/47 (87%), Positives = 41/47 (87%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 ME KEEDV LGANKY E QPIGTAAQSQDD KDYKEPPPAPL EPGE Sbjct: 1 MEAKEEDVSLGANKYPERQPIGTAAQSQDDGKDYKEPPPAPLFEPGE 47 >ref|NP_001274378.1| probable aquaporin PIP1-4-like [Cucumis sativus] gi|562745004|gb|AHB33475.1| plasma intrinsic protein 1-2 [Cucumis sativus] gi|700195461|gb|KGN50638.1| hypothetical protein Csa_5G198770 [Cucumis sativus] Length = 292 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQDD+KDYKEPPPAPL EP E Sbjct: 1 MEGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEE 47 >ref|XP_008463222.1| PREDICTED: probable aquaporin PIP1-4 [Cucumis melo] gi|307136039|gb|ADN33892.1| aquaporin [Cucumis melo subsp. melo] Length = 292 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQDD+KDYKEPPPAPL EP E Sbjct: 1 MEGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEE 47 >ref|NP_001267686.1| uncharacterized protein LOC101215145 [Cucumis sativus] gi|124482178|gb|ABN11916.1| aquaporin [Cucumis sativus] gi|700195463|gb|KGN50640.1| hypothetical protein Csa_5G199280 [Cucumis sativus] Length = 292 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQDD+KDYKEPPPAPL EP E Sbjct: 1 MEGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEE 47 >ref|NP_001280914.1| probable aquaporin PIP1-4 [Malus domestica] gi|46092504|dbj|BAD14372.1| plasma membrane intrinsic protein [Malus domestica] gi|350543334|gb|AEQ29856.1| aquaporin PIP1 [Malus prunifolia] Length = 289 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDVKLGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVKLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >ref|XP_008233728.1| PREDICTED: probable aquaporin PIP1-4 [Prunus mume] Length = 290 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDVKLGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVKLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >ref|XP_007218768.1| hypothetical protein PRUPE_ppa009506mg [Prunus persica] gi|403234152|gb|AFR31804.1| aquaporin PIP1-1 [Prunus persica] gi|462415230|gb|EMJ19967.1| hypothetical protein PRUPE_ppa009506mg [Prunus persica] Length = 290 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDVKLGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVKLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >gb|ACR54285.1| aquaporin [Juglans regia] Length = 292 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQDD KDY EPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKFPERQPIGTAAQSQDDGKDYTEPPPAPLFEPGE 47 >dbj|BAF62342.1| aquaporin [Prunus persica] Length = 289 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDVKLGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVKLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >dbj|BAF44223.1| aquaporin [Iris x hollandica] Length = 327 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDVKLGANK+ E QPIGTAAQ D+SKDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVKLGANKFSERQPIGTAAQVADESKDYKEPPPAPLFEPGE 47 >dbj|BAB40142.1| plasma membrane intrinsic protein 1-1 [Pyrus communis] Length = 289 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >ref|XP_009350886.1| PREDICTED: probable aquaporin PIP1-4 [Pyrus x bretschneideri] Length = 289 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGT+AQ+QD+ KDYKEPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKFSERQPIGTSAQTQDEGKDYKEPPPAPLFEPGE 47 >ref|XP_007009059.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao] gi|508725972|gb|EOY17869.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao] Length = 289 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQD+ KDY EPPPAPL EPGE Sbjct: 1 MEGKEEDVRLGANKFSERQPIGTAAQSQDEEKDYTEPPPAPLFEPGE 47 >gb|ABK60194.1| PIP1 protein [Gossypium hirsutum] gi|728851147|gb|KHG30590.1| putative aquaporin PIP-type 7a [Gossypium arboreum] Length = 289 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -3 Query: 142 MEGKEEDVKLGANKYRETQPIGTAAQSQDDSKDYKEPPPAPLIEPGE 2 MEGKEEDV+LGANK+ E QPIGTAAQSQDD KDY EPPPAP EPGE Sbjct: 1 MEGKEEDVRLGANKFTERQPIGTAAQSQDDGKDYTEPPPAPFFEPGE 47