BLASTX nr result
ID: Ziziphus21_contig00008955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008955 (626 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ22090.1| cytochrome c oxidase subunit 3 [Cycas taitungensis] 101 3e-19 gb|ALE29212.1| cytochrome c oxidase subunit 3 (mitochondrion) [H... 100 7e-19 gb|KOM25339.1| hypothetical protein LR48_Vigan98s000600 [Vigna a... 100 7e-19 gb|AKZ24690.1| cytochrome c oxidase subunit 3 (mitochondrion) [P... 100 7e-19 gb|AKZ24689.1| cytochrome c oxidase subunit 3 (mitochondrion) [P... 100 7e-19 gb|AKZ24686.1| cytochrome c oxidase subunit 3 (mitochondrion) [C... 100 7e-19 dbj|BAO50912.1| cytochrome c oxidase subunit 3 (mitochondrion) [... 100 7e-19 ref|YP_173456.1| cytochrome oxidase subunit 3 [Nicotiana tabacum... 100 7e-19 sp|P14853.1|COX3_SOYBN RecName: Full=Cytochrome c oxidase subuni... 100 7e-19 ref|YP_007516854.1| cytochrome c oxidase subunit III (mitochondr... 100 7e-19 sp|Q03227.1|COX3_VICFA RecName: Full=Cytochrome c oxidase subuni... 100 7e-19 gb|AKE33980.1| cytochrome c oxidase subunit 3, partial (mitochon... 100 7e-19 gb|AHF22726.1| cytochrome c oxidase subunit 3, partial (mitochon... 100 7e-19 gb|AHF22721.1| cytochrome c oxidase subunit 3, partial (mitochon... 100 7e-19 ref|YP_009049736.1| cytochrome oxidase subunit 3 (mitochondrion)... 100 7e-19 gb|AAD42901.1|AF161329_1 cytochrome c oxidase subunit 3 [Solanum... 100 7e-19 gb|AAW65846.1| cytochrome c oxidase subunit 3, partial (mitochon... 100 7e-19 ref|YP_006666135.1| cytochrome c oxidase subunit III (mitochondr... 100 7e-19 ref|XP_013442831.1| cytochrome C oxidase subunit 3 [Medicago tru... 100 7e-19 gb|AEN56100.1| cytochrome c oxidase subunit 3 [Cucumis melo subs... 100 7e-19 >dbj|BAJ22090.1| cytochrome c oxidase subunit 3 [Cycas taitungensis] Length = 265 Score = 101 bits (252), Expect = 3e-19 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = +3 Query: 456 KQNSLLGYSVATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 K+ + SVATVSLALVFTGFQGMEYYQAPFTISD IYGSTFFLATGFHGFHVIIG Sbjct: 158 KEQQAVHASVATVSLALVFTGFQGMEYYQAPFTISDGIYGSTFFLATGFHGFHVIIG 214 >gb|ALE29212.1| cytochrome c oxidase subunit 3 (mitochondrion) [Heuchera parviflora var. saurensis] gi|927682201|gb|ALE29213.1| cytochrome c oxidase subunit 3 (mitochondrion) [Heuchera parviflora var. saurensis] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|KOM25339.1| hypothetical protein LR48_Vigan98s000600 [Vigna angularis] Length = 166 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 89 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 136 >gb|AKZ24690.1| cytochrome c oxidase subunit 3 (mitochondrion) [Physalis virginiana] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AKZ24689.1| cytochrome c oxidase subunit 3 (mitochondrion) [Physalis heterophylla] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AKZ24686.1| cytochrome c oxidase subunit 3 (mitochondrion) [Convolvulus arvensis] gi|916446275|gb|AKZ24687.1| cytochrome c oxidase subunit 3 (mitochondrion) [Ipomoea leptophylla] gi|916446277|gb|AKZ24688.1| cytochrome c oxidase subunit 3 (mitochondrion) [Evolvulus nuttallianus] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >dbj|BAO50912.1| cytochrome c oxidase subunit 3 (mitochondrion) [Hevea brasiliensis] gi|584592164|dbj|BAO50915.1| cytochrome c oxidase subunit 3 (mitochondrion) [Hevea brasiliensis] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >ref|YP_173456.1| cytochrome oxidase subunit 3 [Nicotiana tabacum] gi|698585446|ref|XP_009778652.1| PREDICTED: cytochrome c oxidase subunit 3 [Nicotiana sylvestris] gi|756762115|gb|AJM70223.1| cytochrome c oxidase subunit 3 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] gi|927029477|gb|ALD61771.1| cytochrome oxidase subunit 3 (mitochondrion) [Nicotiana tabacum] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >sp|P14853.1|COX3_SOYBN RecName: Full=Cytochrome c oxidase subunit 3; AltName: Full=Cytochrome c oxidase polypeptide III Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >ref|YP_007516854.1| cytochrome c oxidase subunit III (mitochondrion) [Glycine max] gi|571493629|ref|XP_006592610.1| PREDICTED: cytochrome c oxidase subunit 3-like [Glycine max] gi|12977|emb|CAA33227.1| unnamed protein product [Glycine max] gi|403311550|gb|AFR34298.1| cytochrome c oxidase subunit III (mitochondrion) [Glycine max] gi|947077310|gb|KRH26150.1| hypothetical protein GLYMA_12G155300 [Glycine max] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >sp|Q03227.1|COX3_VICFA RecName: Full=Cytochrome c oxidase subunit 3; AltName: Full=Cytochrome c oxidase polypeptide III gi|14121|emb|CAA35988.1| cytochrome c oxidase [Vicia faba] gi|442803137|gb|AGC78872.1| cytochrome c oxidase subunit III (mitochondrion) [Vicia faba] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AKE33980.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria iinumae] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AHF22726.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. bracteata] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AHF22721.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria mandshurica] gi|571034539|gb|AHF22722.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|571034545|gb|AHF22725.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. vesca] gi|571034549|gb|AHF22727.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|814606925|gb|AKE33978.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria mandshurica] gi|814606927|gb|AKE33979.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. bracteata] gi|814606931|gb|AKE33981.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria vesca subsp. bracteata] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >ref|YP_009049736.1| cytochrome oxidase subunit 3 (mitochondrion) [Capsicum annuum] gi|814071738|ref|YP_009121975.1| cytochrome c oxidase subunit 3 (mitochondrion) [Hyoscyamus niger] gi|667751841|gb|AIG89928.1| cytochrome oxidase subunit 3 (mitochondrion) [Capsicum annuum] gi|667752009|gb|AIG90095.1| cytochrome oxidase subunit 3 (mitochondrion) [Capsicum annuum] gi|756142165|gb|AJK91376.1| cytochrome c oxidase subunit 3 (mitochondrion) [Hyoscyamus niger] gi|916446286|gb|AKZ24691.1| cytochrome c oxidase subunit 3 (mitochondrion) [Solanum carolinense] gi|916446289|gb|AKZ24692.1| cytochrome c oxidase subunit 3 (mitochondrion) [Solanum rostratum] gi|916446291|gb|AKZ24693.1| cytochrome c oxidase subunit 3 (mitochondrion) [Solanum triflorum] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AAD42901.1|AF161329_1 cytochrome c oxidase subunit 3 [Solanum chacoense] Length = 171 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 111 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 158 >gb|AAW65846.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Blossfeldia liliputana] Length = 197 Score = 100 bits (249), Expect = 7e-19 Identities = 49/57 (85%), Positives = 50/57 (87%) Frame = +3 Query: 456 KQNSLLGYSVATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 KQ +G VATV LA VFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 113 KQKRAVGALVATVLLACVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 169 >ref|YP_006666135.1| cytochrome c oxidase subunit III (mitochondrion) [Malus domestica] gi|401661938|emb|CBX33397.1| cox3 (mitochondrion) [Malus domestica] gi|571034535|gb|AHF22720.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria iinumae] gi|571034541|gb|AHF22723.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria chiloensis] gi|571034543|gb|AHF22724.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria virginiana] gi|814606933|gb|AKE33982.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria virginiana] gi|814606935|gb|AKE33983.1| cytochrome c oxidase subunit 3, partial (mitochondrion) [Fragaria chiloensis] gi|939462368|gb|ALJ78523.1| cytochrome oxidase subunit 3 (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >ref|XP_013442831.1| cytochrome C oxidase subunit 3 [Medicago truncatula] gi|657370795|gb|KEH16856.1| cytochrome C oxidase subunit 3 [Medicago truncatula] Length = 324 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214 >gb|AEN56100.1| cytochrome c oxidase subunit 3 [Cucumis melo subsp. melo] Length = 265 Score = 100 bits (249), Expect = 7e-19 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 483 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 626 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG Sbjct: 167 VATVSLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIG 214