BLASTX nr result
ID: Ziziphus21_contig00008765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008765 (512 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105234.1| Argininosuccinate synthase [Morus notabilis]... 61 4e-07 ref|XP_008239446.1| PREDICTED: argininosuccinate synthase, chlor... 58 3e-06 >ref|XP_010105234.1| Argininosuccinate synthase [Morus notabilis] gi|587916458|gb|EXC04121.1| Argininosuccinate synthase [Morus notabilis] Length = 925 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/54 (55%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -1 Query: 167 QASILYHDKVCCARKFLSGYQLGARTSELHGNVYAVISKDGSDSRAH-KQVVRA 9 +AS+LY+ ++CC K S +QLGARTSELHGN IS +GS + +H KQV+RA Sbjct: 451 RASLLYNGRMCCPGKLSSAFQLGARTSELHGNASVSISTNGSVNSSHNKQVIRA 504 >ref|XP_008239446.1| PREDICTED: argininosuccinate synthase, chloroplastic [Prunus mume] Length = 494 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -1 Query: 161 SILYHDKVCCARKFLSGYQLGARTSELHGNVYAVISKDGSDSRAH-KQVVRAV 6 S YH KVCC K S + GAR SEL GN +AV S +GS +RAH KQV+RAV Sbjct: 24 SFPYHGKVCCPGKLSSFQEFGARKSELQGNAFAVSSGNGSVTRAHGKQVIRAV 76