BLASTX nr result
ID: Ziziphus21_contig00008732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008732 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012066125.1| PREDICTED: uncharacterized protein DDB_G0284... 57 5e-06 >ref|XP_012066125.1| PREDICTED: uncharacterized protein DDB_G0284459 [Jatropha curcas] gi|643736819|gb|KDP43090.1| hypothetical protein JCGZ_25276 [Jatropha curcas] Length = 292 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -1 Query: 318 KKTMKRNDSMANNSTTSSKVSPKPLLSDGSAGKGVDKEWWKKRF 187 +K K N NNS +VSPKPLL DGSA VD EWWK RF Sbjct: 192 RKKKKNNSGTVNNSVRDGRVSPKPLLFDGSAKSSVDNEWWKNRF 235