BLASTX nr result
ID: Ziziphus21_contig00008677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008677 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012077962.1| PREDICTED: ubiquitin receptor RAD23c-like is... 57 7e-06 ref|XP_012077961.1| PREDICTED: ubiquitin receptor RAD23d-like is... 57 7e-06 ref|XP_012077959.1| PREDICTED: ubiquitin receptor RAD23c-like is... 57 7e-06 ref|XP_012077958.1| PREDICTED: ubiquitin receptor RAD23c-like is... 57 7e-06 ref|XP_012077957.1| PREDICTED: ubiquitin receptor RAD23c-like is... 57 7e-06 gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas] 57 7e-06 ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassi... 56 9e-06 ref|XP_013647730.1| PREDICTED: ubiquitin receptor RAD23d [Brassi... 56 9e-06 ref|XP_013588046.1| PREDICTED: ubiquitin receptor RAD23d [Brassi... 56 9e-06 gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlise... 56 9e-06 >ref|XP_012077962.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Jatropha curcas] Length = 382 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 137 SSESDVYGQAASNLVAGNNLEATIQQILDMG 167 >ref|XP_012077961.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Jatropha curcas] Length = 394 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 149 SSESDVYGQAASNLVAGNNLEATIQQILDMG 179 >ref|XP_012077959.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Jatropha curcas] Length = 318 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 137 SSESDVYGQAASNLVAGNNLEATIQQILDMG 167 >ref|XP_012077958.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Jatropha curcas] Length = 319 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 138 SSESDVYGQAASNLVAGNNLEATIQQILDMG 168 >ref|XP_012077957.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Jatropha curcas] Length = 382 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 137 SSESDVYGQAASNLVAGNNLEATIQQILDMG 167 >gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas] Length = 382 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S SDVYGQAASNLVAGNNLE+TIQQILDMG Sbjct: 137 SSESDVYGQAASNLVAGNNLEATIQQILDMG 167 >ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa] Length = 382 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S +DVYGQAASNLVAGNNLEST+QQILDMG Sbjct: 133 STQTDVYGQAASNLVAGNNLESTVQQILDMG 163 >ref|XP_013647730.1| PREDICTED: ubiquitin receptor RAD23d [Brassica napus] gi|674965161|emb|CDX67404.1| BnaA07g14440D [Brassica napus] Length = 382 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S +DVYGQAASNLVAGNNLEST+QQILDMG Sbjct: 133 STQTDVYGQAASNLVAGNNLESTVQQILDMG 163 >ref|XP_013588046.1| PREDICTED: ubiquitin receptor RAD23d [Brassica oleracea var. oleracea] gi|674874967|emb|CDY58121.1| BnaCnng32650D [Brassica napus] Length = 384 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 94 SPGSDVYGQAASNLVAGNNLESTIQQILDMG 2 S +DVYGQAASNLVAGNNLEST+QQILDMG Sbjct: 135 STQTDVYGQAASNLVAGNNLESTVQQILDMG 165 >gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea] Length = 389 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 91 PGSDVYGQAASNLVAGNNLESTIQQILDMG 2 P SDVY QAASNLVAGNNLE TIQQILDMG Sbjct: 140 PSSDVYSQAASNLVAGNNLEGTIQQILDMG 169