BLASTX nr result
ID: Ziziphus21_contig00008522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008522 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH13327.1| hypothetical protein GLYMA_15G231500, partial [Gl... 86 1e-14 ref|XP_006598589.1| PREDICTED: putative disease resistance RPP13... 86 1e-14 ref|XP_003599368.2| LRR and NB-ARC domain disease resistance pro... 84 5e-14 ref|XP_003599357.2| LRR and NB-ARC domain disease resistance pro... 82 1e-13 ref|XP_009335855.1| PREDICTED: putative disease resistance prote... 81 4e-13 ref|XP_012073224.1| PREDICTED: putative disease resistance RPP13... 80 8e-13 ref|XP_013444833.1| LRR and NB-ARC domain disease resistance pro... 79 2e-12 ref|XP_013458961.1| LRR and NB-ARC domain disease resistance pro... 78 3e-12 ref|XP_013442572.1| LRR and NB-ARC domain disease resistance pro... 78 3e-12 ref|XP_013442571.1| LRR and NB-ARC domain disease resistance pro... 78 3e-12 ref|XP_003631045.1| NB-ARC domain disease resistance protein [Me... 78 3e-12 ref|XP_003598470.1| LRR and NB-ARC domain disease resistance pro... 78 3e-12 ref|XP_008348458.1| PREDICTED: putative disease resistance RPP13... 77 4e-12 emb|CBI40678.3| unnamed protein product [Vitis vinifera] 77 5e-12 ref|XP_002265391.1| PREDICTED: putative disease resistance RPP13... 77 5e-12 ref|XP_013442817.1| NB-ARC domain disease resistance protein, pu... 77 7e-12 ref|XP_009338823.1| PREDICTED: putative disease resistance prote... 76 9e-12 ref|XP_009338822.1| PREDICTED: putative disease resistance RPP13... 76 9e-12 ref|XP_009338821.1| PREDICTED: putative disease resistance RPP13... 76 9e-12 ref|XP_003599404.1| LRR and NB-ARC domain disease resistance pro... 75 1e-11 >gb|KRH13327.1| hypothetical protein GLYMA_15G231500, partial [Glycine max] Length = 1111 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/67 (55%), Positives = 52/67 (77%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++ + C LYNLQTL L HC +L LPDS+ N+KHLR LDLS+T +E++P++ Sbjct: 577 DLSHTDIEKLTESTCSLYNLQTLKLNHCRSLKELPDSVCNLKHLRSLDLSHTDIEKLPES 636 Query: 23 LCNLHNL 3 C+L+NL Sbjct: 637 TCSLYNL 643 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L HC ++ LPDS+ N KHLR LDLS+T +E++ ++ C+L+NL Sbjct: 549 LRVLSLSHCLDIKELPDSVCNFKHLRSLDLSHTDIEKLTESTCSLYNL 596 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/67 (40%), Positives = 41/67 (61%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P + C LYNLQ L L C L LP ++ + +LR L+ +T++ ++P Sbjct: 624 DLSHTDIEKLPESTCSLYNLQILKLNDCIYLMELPSNLHELINLRRLEFVDTEIIKVPPH 683 Query: 23 LCNLHNL 3 L L NL Sbjct: 684 LGKLKNL 690 >ref|XP_006598589.1| PREDICTED: putative disease resistance RPP13-like protein 1-like, partial [Glycine max] Length = 1146 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/67 (55%), Positives = 52/67 (77%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++ + C LYNLQTL L HC +L LPDS+ N+KHLR LDLS+T +E++P++ Sbjct: 612 DLSHTDIEKLTESTCSLYNLQTLKLNHCRSLKELPDSVCNLKHLRSLDLSHTDIEKLPES 671 Query: 23 LCNLHNL 3 C+L+NL Sbjct: 672 TCSLYNL 678 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L HC ++ LPDS+ N KHLR LDLS+T +E++ ++ C+L+NL Sbjct: 584 LRVLSLSHCLDIKELPDSVCNFKHLRSLDLSHTDIEKLTESTCSLYNL 631 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/67 (40%), Positives = 41/67 (61%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P + C LYNLQ L L C L LP ++ + +LR L+ +T++ ++P Sbjct: 659 DLSHTDIEKLPESTCSLYNLQILKLNDCIYLMELPSNLHELINLRRLEFVDTEIIKVPPH 718 Query: 23 LCNLHNL 3 L L NL Sbjct: 719 LGKLKNL 725 >ref|XP_003599368.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657392266|gb|AES69619.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1293 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+TEI +P+ C LYNLQTL+L C L+ LP IGN+ L++LDLS T++E +PDA Sbjct: 610 DLSFTEIESLPDATCNLYNLQTLILSSCEGLTKLPVHIGNLVQLQYLDLSFTEIESLPDA 669 Query: 23 LCNLHNL 3 CNL+NL Sbjct: 670 TCNLYNL 676 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/67 (49%), Positives = 46/67 (68%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+TEI +P+ C LYNL+TL+L C +L+ LP IGN+ LRHLD+S T + ++P Sbjct: 657 DLSFTEIESLPDATCNLYNLKTLILSSCESLTELPLHIGNLVSLRHLDISETNISKLPME 716 Query: 23 LCNLHNL 3 + L NL Sbjct: 717 MLKLTNL 723 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = -3 Query: 176 IPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 + + I L L+ L L N++ LPD+IG + LR+LDLS T++E +PDA CNL+NL Sbjct: 572 VDDLIPSLKRLRVLSLSKYKNITKLPDTIGKLVQLRYLDLSFTEIESLPDATCNLYNL 629 >ref|XP_003599357.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657392259|gb|AES69608.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1288 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+TEI +P C LYNLQTL+L C L+ LP IGN+ L++LDLS T++E +PDA Sbjct: 607 DLSFTEIESLPYATCNLYNLQTLILSSCEGLTKLPVHIGNLVQLQYLDLSFTEIESLPDA 666 Query: 23 LCNLHNL 3 CNL+NL Sbjct: 667 TCNLYNL 673 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/67 (49%), Positives = 46/67 (68%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+TEI +P+ C LYNL+TL+L C +L+ LP IGN+ LRHLD+S T + ++P Sbjct: 654 DLSFTEIESLPDATCNLYNLKTLILSSCESLTELPLHIGNLVSLRHLDISETNISKLPME 713 Query: 23 LCNLHNL 3 + L NL Sbjct: 714 MLKLTNL 720 >ref|XP_009335855.1| PREDICTED: putative disease resistance protein At3g14460 [Pyrus x bretschneideri] Length = 1182 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/67 (49%), Positives = 49/67 (73%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+SWT I E+P+ +C LYNLQTLLL+ C L LP +G + +LRHL++ T+++++P Sbjct: 585 DVSWTSITELPDKVCNLYNLQTLLLEACHRLIQLPSELGRLINLRHLNIRGTKIKQMPAG 644 Query: 23 LCNLHNL 3 +CNL NL Sbjct: 645 MCNLKNL 651 >ref|XP_012073224.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Jatropha curcas] gi|802539879|ref|XP_012073233.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Jatropha curcas] gi|802539881|ref|XP_012073242.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Jatropha curcas] gi|802539883|ref|XP_012073249.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Jatropha curcas] gi|643740509|gb|KDP46107.1| hypothetical protein JCGZ_06618 [Jatropha curcas] Length = 1177 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/67 (53%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 +LS I +P + LYNLQTL+L C NL+ LPDSIGN+KHLRHLDLS T + +P++ Sbjct: 598 NLSTASIKSLPEIVSILYNLQTLILHECTNLAVLPDSIGNLKHLRHLDLSGTSIISLPES 657 Query: 23 LCNLHNL 3 +C L +L Sbjct: 658 ICGLCDL 664 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T I +P +ICGL +L+TL+L C +L LP + + +LRHLD+ T+++E+P Sbjct: 645 DLSGTSIISLPESICGLCDLRTLILCQCKDLIELPTQMARLINLRHLDIGGTKLQEMPPR 704 Query: 23 LCNLHNL 3 + L NL Sbjct: 705 MGELKNL 711 >ref|XP_013444833.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657373098|gb|KEH18858.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1220 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/67 (53%), Positives = 49/67 (73%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T I +P+TIC LYNLQTLLL C L+ LP +GN+ +LRHLD+S+T ++E+P Sbjct: 612 DLSSTNIGSLPDTICNLYNLQTLLLSRCQCLTELPVHMGNLINLRHLDISSTDIKELPME 671 Query: 23 LCNLHNL 3 +C L +L Sbjct: 672 ICGLESL 678 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -3 Query: 155 LYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L L L L N+ LPDSIGN+ LR+LDLS+T + +PD +CNL+NL Sbjct: 581 LKRLHVLSLSKYTNIFELPDSIGNLVQLRYLDLSSTNIGSLPDTICNLYNL 631 >ref|XP_013458961.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657391892|gb|KEH33003.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1212 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P+ IC LYNLQTLLL C +L+ LP+ IGN+ +LRHLDLS+T+++ +P Sbjct: 614 DLSNTKIEKLPDVICKLYNLQTLLLSKCSSLTELPEDIGNLVNLRHLDLSDTKLKVMPIQ 673 Query: 23 LCNLHNL 3 + L NL Sbjct: 674 IAKLQNL 680 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L H N++ LP+S N+ HLR+LDLSNT++E++PD +C L+NL Sbjct: 586 LRVLSLSHYNNITELPNSFVNLIHLRYLDLSNTKIEKLPDVICKLYNL 633 >ref|XP_013442572.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657370481|gb|KEH16597.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 630 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P+ IC LYNLQTLLL C +L+ LP+ IGN+ +LRHLDLS+T+++ +P Sbjct: 32 DLSNTKIEKLPDVICKLYNLQTLLLSKCSSLTELPEDIGNLVNLRHLDLSDTKLKVMPIQ 91 Query: 23 LCNLHNL 3 + L NL Sbjct: 92 IAKLQNL 98 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L H N++ LP+S N+ HLR+LDLSNT++E++PD +C L+NL Sbjct: 4 LRVLSLSHYNNITELPNSFVNLIHLRYLDLSNTKIEKLPDVICKLYNL 51 >ref|XP_013442571.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|657370480|gb|KEH16596.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 665 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P+ IC LYNLQTLLL C +L+ LP+ IGN+ +LRHLDLS+T+++ +P Sbjct: 32 DLSNTKIEKLPDVICKLYNLQTLLLSKCSSLTELPEDIGNLVNLRHLDLSDTKLKVMPIQ 91 Query: 23 LCNLHNL 3 + L NL Sbjct: 92 IAKLQNL 98 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L H N++ LP+S N+ HLR+LDLSNT++E++PD +C L+NL Sbjct: 4 LRVLSLSHYNNITELPNSFVNLIHLRYLDLSNTKIEKLPDVICKLYNL 51 >ref|XP_003631045.1| NB-ARC domain disease resistance protein [Medicago truncatula] gi|355525067|gb|AET05521.1| NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1118 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/67 (50%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+T I +P+T C LYNL+TL+L CCNL+ LP ++GN+ +LRHLD+ T ++E P Sbjct: 542 DLSFTRIKSLPDTTCNLYNLETLILVDCCNLTELPVNMGNLINLRHLDIIGTDIKEFPIE 601 Query: 23 LCNLHNL 3 + L NL Sbjct: 602 IGGLENL 608 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/65 (41%), Positives = 42/65 (64%) Frame = -3 Query: 197 SWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALC 18 ++ + + + I L L+ L L N++ LPDSIGN+ HLR+ DLS T+++ +PD C Sbjct: 497 NYLSLKVVDDLIPTLKRLRMLSLSAYRNITKLPDSIGNLVHLRYPDLSFTRIKSLPDTTC 556 Query: 17 NLHNL 3 NL+NL Sbjct: 557 NLYNL 561 >ref|XP_003598470.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|355487518|gb|AES68721.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1247 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS T+I ++P+ IC LYNLQTLLL C +L+ LP+ IGN+ +LRHLDLS+T+++ +P Sbjct: 614 DLSNTKIEKLPDVICKLYNLQTLLLSKCSSLTELPEDIGNLVNLRHLDLSDTKLKVMPIQ 673 Query: 23 LCNLHNL 3 + L NL Sbjct: 674 IAKLQNL 680 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 146 LQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDALCNLHNL 3 L+ L L H N++ LP+S N+ HLR+LDLSNT++E++PD +C L+NL Sbjct: 586 LRVLSLSHYNNITELPNSFVNLIHLRYLDLSNTKIEKLPDVICKLYNL 633 >ref|XP_008348458.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Malus domestica] Length = 1019 Score = 77.4 bits (189), Expect = 4e-12 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S+T I E+P T+C LYNLQTLLL C L LP ++G + +LRHL++ T +E++P Sbjct: 615 DMSYTSIRELPETVCTLYNLQTLLLVDCRRLIQLPSNLGRLINLRHLNIRYTDIEKMPAG 674 Query: 23 LCNLHNL 3 +CN+ NL Sbjct: 675 MCNMKNL 681 >emb|CBI40678.3| unnamed protein product [Vitis vinifera] Length = 1243 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/67 (50%), Positives = 50/67 (74%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+T + +P++ C LYNLQTLLL +CC+LS LP ++G + +LRHLD+S T V+E+P Sbjct: 583 DLSYTGLRNLPDSTCNLYNLQTLLLSNCCSLSELPANMGKLINLRHLDISQTNVKEMPTQ 642 Query: 23 LCNLHNL 3 + L +L Sbjct: 643 IGRLGSL 649 >ref|XP_002265391.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Length = 1308 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/67 (50%), Positives = 50/67 (74%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 DLS+T + +P++ C LYNLQTLLL +CC+LS LP ++G + +LRHLD+S T V+E+P Sbjct: 604 DLSYTGLRNLPDSTCNLYNLQTLLLSNCCSLSELPANMGKLINLRHLDISQTNVKEMPTQ 663 Query: 23 LCNLHNL 3 + L +L Sbjct: 664 IGRLGSL 670 >ref|XP_013442817.1| NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] gi|657370780|gb|KEH16842.1| NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 828 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/67 (52%), Positives = 47/67 (70%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S+T I +P+TIC LYNLQTL L +C +L+ LP IGN+ LRHLD+S T + E+P Sbjct: 155 DISFTGIESLPDTICNLYNLQTLNLSNCWSLTELPIHIGNLVSLRHLDISGTNINELPVE 214 Query: 23 LCNLHNL 3 + L NL Sbjct: 215 IAGLENL 221 >ref|XP_009338823.1| PREDICTED: putative disease resistance protein At3g14460 isoform X3 [Pyrus x bretschneideri] Length = 1167 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/67 (47%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S T I E+P+ +C LYNLQTLLL+ C L LP +G + +LRHL++ T+++++P Sbjct: 613 DVSQTSITELPDKVCNLYNLQTLLLEACHQLIQLPSELGRLINLRHLNIRGTEIKQMPAG 672 Query: 23 LCNLHNL 3 +CNL NL Sbjct: 673 MCNLKNL 679 >ref|XP_009338822.1| PREDICTED: putative disease resistance RPP13-like protein 1 isoform X2 [Pyrus x bretschneideri] Length = 1221 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/67 (47%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S T I E+P+ +C LYNLQTLLL+ C L LP +G + +LRHL++ T+++++P Sbjct: 587 DVSQTSITELPDKVCNLYNLQTLLLEACHQLIQLPSELGRLINLRHLNIRGTEIKQMPAG 646 Query: 23 LCNLHNL 3 +CNL NL Sbjct: 647 MCNLKNL 653 >ref|XP_009338821.1| PREDICTED: putative disease resistance RPP13-like protein 1 isoform X1 [Pyrus x bretschneideri] Length = 1247 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/67 (47%), Positives = 48/67 (71%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S T I E+P+ +C LYNLQTLLL+ C L LP +G + +LRHL++ T+++++P Sbjct: 613 DVSQTSITELPDKVCNLYNLQTLLLEACHQLIQLPSELGRLINLRHLNIRGTEIKQMPAG 672 Query: 23 LCNLHNL 3 +CNL NL Sbjct: 673 MCNLKNL 679 >ref|XP_003599404.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|355488452|gb|AES69655.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1247 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = -3 Query: 203 DLSWTEINEIPNTICGLYNLQTLLLQHCCNLSHLPDSIGNMKHLRHLDLSNTQVEEIPDA 24 D+S+T I +P+T C LYNLQTL+L C +L+ LP IGN+ LRHLD+S T + E+P Sbjct: 606 DISFTNIKSLPDTTCSLYNLQTLILSRCDSLTELPVHIGNLVSLRHLDISGTNINELPVE 665 Query: 23 LCNLHNL 3 + L NL Sbjct: 666 IGRLENL 672