BLASTX nr result
ID: Ziziphus21_contig00008383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008383 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09790.1| hypothetical protein B456_001G166300 [Gossypium r... 62 8e-10 >gb|KJB09790.1| hypothetical protein B456_001G166300 [Gossypium raimondii] Length = 571 Score = 61.6 bits (148), Expect(2) = 8e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 122 VLYRPHSIFLPNEPISLLIWKTGVAFGSKKAWFSV 18 VLYRPHSIFLPNEPI LL WKTGVAFGSK FS+ Sbjct: 253 VLYRPHSIFLPNEPIYLLTWKTGVAFGSKGMVFSM 287 Score = 28.1 bits (61), Expect(2) = 8e-10 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 36 KGMVFSMSPDRA 1 KGMVFSMSPDRA Sbjct: 281 KGMVFSMSPDRA 292