BLASTX nr result
ID: Ziziphus21_contig00008172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008172 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008240630.1| PREDICTED: grpE protein homolog, mitochondri... 64 4e-08 ref|XP_002319738.1| co-chaperone grpE family protein [Populus tr... 63 7e-08 ref|XP_012070349.1| PREDICTED: grpE protein homolog, mitochondri... 62 2e-07 ref|XP_007202333.1| hypothetical protein PRUPE_ppa008162mg [Prun... 62 2e-07 ref|XP_010088168.1| hypothetical protein L484_004148 [Morus nota... 59 1e-06 ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondri... 58 3e-06 ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondri... 58 3e-06 >ref|XP_008240630.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume] gi|645270823|ref|XP_008240631.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume] Length = 343 Score = 63.9 bits (154), Expect = 4e-08 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = -3 Query: 183 STFSSNSPKPLCVSFRRSD-GTKFSPARTSLRFSRLLSQRFVKFVPFASQGETETAETEE 7 ST S NSPKP VSFR+S G+ +SLRFS L S RF KFVP ASQGETET ET E Sbjct: 19 STLSPNSPKPSYVSFRQSQSGSIPYLTLSSLRFSHLPSLRFAKFVPLASQGETETTETVE 78 >ref|XP_002319738.1| co-chaperone grpE family protein [Populus trichocarpa] gi|222858114|gb|EEE95661.1| co-chaperone grpE family protein [Populus trichocarpa] Length = 342 Score = 63.2 bits (152), Expect = 7e-08 Identities = 38/82 (46%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = -3 Query: 237 MATVXXXXXXXXXXXPFQSTFSSNSPKPLCVSFRRSDGTK---FSPARTSLRFSRLLSQR 67 MATV S+ S PLC+SF ++ FS A+ SLRF S R Sbjct: 1 MATVIKTPPFSAPRIINNSSISLKYANPLCLSFSHNNNRSIPNFSLAKNSLRFPTKPSLR 60 Query: 66 FVKFVPFASQGETETAETEEVL 1 FVKFVPF+SQGETET ETEE + Sbjct: 61 FVKFVPFSSQGETETTETEETI 82 >ref|XP_012070349.1| PREDICTED: grpE protein homolog, mitochondrial [Jatropha curcas] gi|643732528|gb|KDP39624.1| hypothetical protein JCGZ_02644 [Jatropha curcas] Length = 350 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = -3 Query: 183 STFSSNSPKPLCVSFRRSDGTKFSPARTSLRFSRLLSQRFVKFVPFASQGETETAETEEV 4 + S SP P C+SFRR + + LRF S RF+KFVPFA+QGETET ETEE Sbjct: 24 NNLSLQSPNPFCLSFRRRSISTEVSRTSCLRFPVKSSHRFIKFVPFATQGETETTETEET 83 Query: 3 L 1 + Sbjct: 84 I 84 >ref|XP_007202333.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica] gi|462397864|gb|EMJ03532.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica] Length = 343 Score = 62.0 bits (149), Expect = 2e-07 Identities = 37/60 (61%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 183 STFSSNSPKPLCVSFRRSD-GTKFSPARTSLRFSRLLSQRFVKFVPFASQGETETAETEE 7 ST S NSPKP VSFR+S G+ +SLRF L S RF KFVP ASQGETET ET E Sbjct: 19 STLSPNSPKPSYVSFRQSQSGSIPYLTLSSLRFPHLPSLRFAKFVPLASQGETETTETVE 78 >ref|XP_010088168.1| hypothetical protein L484_004148 [Morus notabilis] gi|587841532|gb|EXB32134.1| hypothetical protein L484_004148 [Morus notabilis] Length = 161 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/63 (52%), Positives = 40/63 (63%) Frame = -3 Query: 189 FQSTFSSNSPKPLCVSFRRSDGTKFSPARTSLRFSRLLSQRFVKFVPFASQGETETAETE 10 FQS + P+ VSF +G+ S A + LRFSR S FVKF PFAS+GETE ETE Sbjct: 16 FQSRLLPSYPRAFRVSFSERNGSIPSRALSCLRFSRSPSLPFVKFAPFASRGETEATETE 75 Query: 9 EVL 1 E+L Sbjct: 76 EIL 78 >ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Populus euphratica] Length = 337 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/82 (42%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Frame = -3 Query: 237 MATVXXXXXXXXXXXPFQSTFSSNSPKPLCVSFRRSDGTK---FSPARTSLRFSRLLSQR 67 MATV S+ S PLC+SF ++ FS + SLRF S R Sbjct: 1 MATVIKTPPFSAPRIINSSSISLKYANPLCLSFSHNNNRSIPNFSLTKNSLRFPTKPSLR 60 Query: 66 FVKFVPFASQGETETAETEEVL 1 FVKF PF+SQGETE ETEE + Sbjct: 61 FVKFAPFSSQGETEITETEETI 82 >ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Populus euphratica] Length = 338 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/82 (42%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Frame = -3 Query: 237 MATVXXXXXXXXXXXPFQSTFSSNSPKPLCVSFRRSDGTK---FSPARTSLRFSRLLSQR 67 MATV S+ S PLC+SF ++ FS + SLRF S R Sbjct: 1 MATVIKTPPFSAPRIINSSSISLKYANPLCLSFSHNNNRSIPNFSLTKNSLRFPTKPSLR 60 Query: 66 FVKFVPFASQGETETAETEEVL 1 FVKF PF+SQGETE ETEE + Sbjct: 61 FVKFAPFSSQGETEITETEETI 82