BLASTX nr result
ID: Ziziphus21_contig00008147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008147 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263235.1| PREDICTED: somatic embryogenesis receptor ki... 97 4e-18 ref|XP_002527489.1| serine-threonine protein kinase, plant-type,... 96 8e-18 ref|NP_001241049.1| somatic embryogenesis receptor kinase 1-like... 95 2e-17 ref|XP_011030366.1| PREDICTED: somatic embryogenesis receptor ki... 95 2e-17 ref|XP_010028380.1| PREDICTED: somatic embryogenesis receptor ki... 94 4e-17 gb|KRH35692.1| hypothetical protein GLYMA_10G258800 [Glycine max] 94 5e-17 ref|NP_001238603.1| uncharacterized protein LOC100306422 precurs... 94 5e-17 ref|XP_012093091.1| PREDICTED: somatic embryogenesis receptor ki... 93 7e-17 ref|XP_002298766.1| putative leucine-rich repeat family protein ... 93 7e-17 ref|XP_009347745.1| PREDICTED: somatic embryogenesis receptor ki... 93 9e-17 ref|XP_008455024.1| PREDICTED: somatic embryogenesis receptor ki... 93 9e-17 ref|XP_008236426.1| PREDICTED: somatic embryogenesis receptor ki... 93 9e-17 ref|XP_007199482.1| hypothetical protein PRUPE_ppb009520mg [Prun... 93 9e-17 ref|XP_004136945.1| PREDICTED: somatic embryogenesis receptor ki... 92 2e-16 gb|AFK44866.1| unknown [Lotus japonicus] 92 2e-16 ref|XP_006486944.1| PREDICTED: somatic embryogenesis receptor ki... 92 2e-16 ref|XP_006422856.1| hypothetical protein CICLE_v10029281mg [Citr... 92 2e-16 ref|XP_002313167.2| hypothetical protein POPTR_0009s09390g [Popu... 92 2e-16 ref|XP_014510807.1| PREDICTED: somatic embryogenesis receptor ki... 91 3e-16 gb|KOM36227.1| hypothetical protein LR48_Vigan02g237700 [Vigna a... 91 3e-16 >ref|XP_002263235.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Vitis vinifera] gi|296083074|emb|CBI22478.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 97.4 bits (241), Expect = 4e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNN+LCGTIPV+GPFA FPMESF+NNRFSGPELQGLVPYDFGC Sbjct: 168 FDVSNNNLCGTIPVDGPFANFPMESFQNNRFSGPELQGLVPYDFGC 213 >ref|XP_002527489.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533129|gb|EEF34887.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 212 Score = 96.3 bits (238), Expect = 8e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPF+TFPMESFENNR +GPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFSTFPMESFENNRLNGPELKGLVPYDFGC 212 >ref|NP_001241049.1| somatic embryogenesis receptor kinase 1-like precursor [Glycine max] gi|223452536|gb|ACM89595.1| leucine-rich repeat family protein [Glycine max] gi|734423708|gb|KHN42327.1| Somatic embryogenesis receptor kinase 1 [Glycine soja] gi|947041364|gb|KRG91088.1| hypothetical protein GLYMA_20G132400 [Glycine max] Length = 212 Score = 95.1 bits (235), Expect = 2e-17 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPVEG F +FPMESFENNRFSGPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVEGNFESFPMESFENNRFSGPELKGLVPYDFGC 212 >ref|XP_011030366.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Populus euphratica] Length = 327 Score = 94.7 bits (234), Expect = 2e-17 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPFA+FPMESFENN+ +GPEL+GLVPYDFGC Sbjct: 282 FDVSNNDLCGTIPVDGPFASFPMESFENNKLNGPELKGLVPYDFGC 327 >ref|XP_010028380.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Eucalyptus grandis] gi|629088865|gb|KCW55118.1| hypothetical protein EUGRSUZ_I01078 [Eucalyptus grandis] Length = 212 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPFA F MESFENNR +GPELQGLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFANFQMESFENNRLNGPELQGLVPYDFGC 212 >gb|KRH35692.1| hypothetical protein GLYMA_10G258800 [Glycine max] Length = 170 Score = 93.6 bits (231), Expect = 5e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPVEG F +FPMESF+NNRFSGPEL+GLVPYDFGC Sbjct: 125 FDVSNNDLCGTIPVEGNFESFPMESFKNNRFSGPELKGLVPYDFGC 170 >ref|NP_001238603.1| uncharacterized protein LOC100306422 precursor [Glycine max] gi|255628489|gb|ACU14589.1| unknown [Glycine max] gi|734330579|gb|KHN06793.1| Somatic embryogenesis receptor kinase 1 [Glycine soja] gi|947086970|gb|KRH35691.1| hypothetical protein GLYMA_10G258800 [Glycine max] Length = 212 Score = 93.6 bits (231), Expect = 5e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPVEG F +FPMESF+NNRFSGPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVEGNFESFPMESFKNNRFSGPELKGLVPYDFGC 212 >ref|XP_012093091.1| PREDICTED: somatic embryogenesis receptor kinase 1-like isoform X1 [Jatropha curcas] gi|802550645|ref|XP_012093092.1| PREDICTED: somatic embryogenesis receptor kinase 1-like isoform X2 [Jatropha curcas] gi|802550647|ref|XP_012093093.1| PREDICTED: somatic embryogenesis receptor kinase 1-like isoform X3 [Jatropha curcas] gi|643738550|gb|KDP44471.1| hypothetical protein JCGZ_16304 [Jatropha curcas] Length = 214 Score = 93.2 bits (230), Expect = 7e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNN+LCGTIPV+GPFATFPMESFENN+ +GPEL+GL PYDFGC Sbjct: 169 FDVSNNELCGTIPVDGPFATFPMESFENNKLNGPELKGLAPYDFGC 214 >ref|XP_002298766.1| putative leucine-rich repeat family protein [Populus trichocarpa] gi|222846024|gb|EEE83571.1| putative leucine-rich repeat family protein [Populus trichocarpa] Length = 212 Score = 93.2 bits (230), Expect = 7e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPF +FPMESFENN+ +GPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFTSFPMESFENNKLNGPELKGLVPYDFGC 212 >ref|XP_009347745.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X1 [Pyrus x bretschneideri] gi|694442078|ref|XP_009347746.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X2 [Pyrus x bretschneideri] gi|694442080|ref|XP_009347747.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X1 [Pyrus x bretschneideri] gi|694442095|ref|XP_009347754.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X1 [Pyrus x bretschneideri] gi|694442097|ref|XP_009347755.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X2 [Pyrus x bretschneideri] gi|694442100|ref|XP_009347756.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X1 [Pyrus x bretschneideri] Length = 212 Score = 92.8 bits (229), Expect = 9e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPF TFPMESFENNR +GPEL+GLV YDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFGTFPMESFENNRLNGPELKGLVSYDFGC 212 >ref|XP_008455024.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis melo] Length = 212 Score = 92.8 bits (229), Expect = 9e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPFATF MES+ NNR SGPELQGLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFATFSMESYINNRLSGPELQGLVPYDFGC 212 >ref|XP_008236426.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Prunus mume] Length = 212 Score = 92.8 bits (229), Expect = 9e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPF TF MESFENNR +GPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFGTFSMESFENNRLNGPELKGLVPYDFGC 212 >ref|XP_007199482.1| hypothetical protein PRUPE_ppb009520mg [Prunus persica] gi|462394882|gb|EMJ00681.1| hypothetical protein PRUPE_ppb009520mg [Prunus persica] Length = 212 Score = 92.8 bits (229), Expect = 9e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPF TF MESFENNR +GPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFGTFSMESFENNRLNGPELKGLVPYDFGC 212 >ref|XP_004136945.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Cucumis sativus] gi|700188626|gb|KGN43859.1| hypothetical protein Csa_7G071480 [Cucumis sativus] Length = 212 Score = 92.0 bits (227), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+GPFATF MES+ NN+ SGPELQGLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGPFATFSMESYVNNKLSGPELQGLVPYDFGC 212 >gb|AFK44866.1| unknown [Lotus japonicus] Length = 212 Score = 92.0 bits (227), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNNDLCGTIPV+G F +FPMESFENNR SGPEL+GLVPYDFGC Sbjct: 167 FDVSNNDLCGTIPVDGNFGSFPMESFENNRLSGPELKGLVPYDFGC 212 >ref|XP_006486944.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Citrus sinensis] Length = 209 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNN LCGTIPV+GPF +FPMESFENN+ +GPELQGLVPYDFGC Sbjct: 164 FDVSNNGLCGTIPVDGPFRSFPMESFENNKLNGPELQGLVPYDFGC 209 >ref|XP_006422856.1| hypothetical protein CICLE_v10029281mg [Citrus clementina] gi|557524790|gb|ESR36096.1| hypothetical protein CICLE_v10029281mg [Citrus clementina] Length = 209 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNN LCGTIPV+GPF +FPMESFENN+ +GPELQGLVPYDFGC Sbjct: 164 FDVSNNGLCGTIPVDGPFRSFPMESFENNKLNGPELQGLVPYDFGC 209 >ref|XP_002313167.2| hypothetical protein POPTR_0009s09390g [Populus trichocarpa] gi|118487854|gb|ABK95750.1| unknown [Populus trichocarpa] gi|550331377|gb|EEE87122.2| hypothetical protein POPTR_0009s09390g [Populus trichocarpa] Length = 212 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 307 FDVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 FDVSNN+LCGTIPV+GPFA+FPMESF NNR +GPEL+GLVPYDFGC Sbjct: 167 FDVSNNNLCGTIPVDGPFASFPMESFANNRLNGPELKGLVPYDFGC 212 >ref|XP_014510807.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Vigna radiata var. radiata] Length = 270 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 304 DVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 DVSNNDLCGTIPVEG F +FPMESFENNRF GPEL+GLVPYDFGC Sbjct: 226 DVSNNDLCGTIPVEGNFESFPMESFENNRFCGPELKGLVPYDFGC 270 >gb|KOM36227.1| hypothetical protein LR48_Vigan02g237700 [Vigna angularis] Length = 271 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 304 DVSNNDLCGTIPVEGPFATFPMESFENNRFSGPELQGLVPYDFGC 170 DVSNNDLCGTIPVEG F +FPMESFENNRF GPEL+GLVPYDFGC Sbjct: 227 DVSNNDLCGTIPVEGNFESFPMESFENNRFCGPELKGLVPYDFGC 271