BLASTX nr result
ID: Ziziphus21_contig00008123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00008123 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008391413.1| PREDICTED: mitochondrial import receptor sub... 82 1e-13 ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 f... 81 3e-13 ref|XP_012079254.1| PREDICTED: mitochondrial import receptor sub... 81 3e-13 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 80 6e-13 ref|XP_008388886.1| PREDICTED: mitochondrial import receptor sub... 78 2e-12 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 78 3e-12 ref|XP_006387863.1| hypothetical protein POPTR_0516s00200g [Popu... 78 3e-12 ref|XP_011077105.1| PREDICTED: mitochondrial import receptor sub... 77 4e-12 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 77 4e-12 ref|XP_011077684.1| PREDICTED: mitochondrial import receptor sub... 77 5e-12 ref|XP_009362070.1| PREDICTED: mitochondrial import receptor sub... 77 5e-12 gb|KDO51506.1| hypothetical protein CISIN_1g0351381mg [Citrus si... 77 5e-12 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 77 5e-12 ref|XP_009370016.1| PREDICTED: mitochondrial import receptor sub... 77 7e-12 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 77 7e-12 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 77 7e-12 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 76 9e-12 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 76 1e-11 ref|XP_009768665.1| PREDICTED: mitochondrial import receptor sub... 76 1e-11 ref|XP_009628067.1| PREDICTED: mitochondrial import receptor sub... 76 1e-11 >ref|XP_008391413.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EERS VAQFVKEW TWTM+K +VVT+YGFIP+VIIIGMNS+PKPQL Q Sbjct: 22 EERS-VAQFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQ 68 >ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|550318729|gb|ERP49995.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+SA +Q+VKEW TWT +K +V+T+YGFIPM+IIIGMNSEPKPQ+YQ Sbjct: 23 EEKSA-SQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQ 69 >ref|XP_012079254.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Jatropha curcas] gi|643722074|gb|KDP31953.1| hypothetical protein JCGZ_12414 [Jatropha curcas] Length = 74 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -3 Query: 254 ERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 E ++AQ +KEW TWTM+K +VVT+YGFIP++IIIGMNSEPKPQLYQ Sbjct: 23 EEKSMAQCLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPQLYQ 69 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE S+ A+ VKEW TW M+K +V+T+YGFIP++I+IGMNSEPKPQLYQ Sbjct: 21 EEGSSAAKCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQ 68 >ref|XP_008388886.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Malus domestica] Length = 133 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 +ERS VAQ VKEW TWTM+K +VVT+YGFIP+VIIIGMNS+PKPQL Q Sbjct: 22 DERS-VAQSVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQ 68 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+S + Q +KEW TWT++K +V+T+YGFIP+V+IIGMNSEPKPQLYQ Sbjct: 24 EEKSTI-QCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQ 70 >ref|XP_006387863.1| hypothetical protein POPTR_0516s00200g [Populus trichocarpa] gi|550308701|gb|ERP46777.1| hypothetical protein POPTR_0516s00200g [Populus trichocarpa] Length = 110 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/48 (68%), Positives = 44/48 (91%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+SA +Q+VKEW TWT +K +V+T+YGFIPM+IIIGM+SEP+PQ+YQ Sbjct: 59 EEKSA-SQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMHSEPEPQIYQ 105 >ref|XP_011077105.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 2/50 (4%) Frame = -3 Query: 257 EERSAV--AQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE S V A+FVKEW TWTM+K +V+T+YGFIPMVIIIGMNSEPKP L Q Sbjct: 24 EEGSMVVAAKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQ 73 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EERSA + VKEW TW M+K +V+T+YGFIP+++IIGMNSEPKPQLYQ Sbjct: 21 EERSA--KCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQ 66 >ref|XP_011077684.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 248 SAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 + A+FVKEW TWTM+K +V+T+YGFIPMVIIIGMNSEPKP L Q Sbjct: 29 AVAAKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQ 73 >ref|XP_009362070.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 254 ERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 E +VAQ VKEW TW M+K +VVT+YGFIP+VIIIGMNS+PKPQL Q Sbjct: 22 EEGSVAQSVKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQ 68 >gb|KDO51506.1| hypothetical protein CISIN_1g0351381mg [Citrus sinensis] Length = 72 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+S V F KEW TWTM+K +VVT+YGFIP++IIIGMNS+PKPQ+YQ Sbjct: 21 EEKSMVDSF-KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQ 67 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+S V F KEW TWTM+K +VVT+YGFIP++IIIGMNS+PKPQ+YQ Sbjct: 21 EEKSMVDSF-KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQ 67 >ref|XP_009370016.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EERS VAQ KEW TW ++K +VVT+YGFIPMVIIIGMNSEPKPQL Q Sbjct: 22 EERS-VAQSFKEWSTWALKKAKVVTHYGFIPMVIIIGMNSEPKPQLSQ 68 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 76.6 bits (187), Expect = 7e-12 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 EE+S + F KEW TWTM+K +VVT+YGFIP++IIIGMNS+PKPQ+YQ Sbjct: 21 EEKSMIDSF-KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQ 67 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|645234757|ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -3 Query: 257 EERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 +ERS VAQ VKEW TW M+K +VVT+YGFIP++I+IGMNSEPKPQL Q Sbjct: 22 DERS-VAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQ 68 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|823261997|ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|763814322|gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gi|763814323|gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] Length = 72 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -3 Query: 254 ERSAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 + + Q +KEW TW M+K +VVT+YGFIP+VIIIGMNSEPKPQLYQ Sbjct: 21 DEKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQ 67 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 248 SAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 + V +FVKEWGTWT +K +V+T+YGFIP+VIIIGMNSEPKP L Q Sbjct: 23 AVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQ 67 >ref|XP_009768665.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana sylvestris] Length = 77 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = -3 Query: 248 SAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 +A+++FVKEWGTWT +K +V+T+YGFIP+VII+GMNSEPKP L Q Sbjct: 28 AALSKFVKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQ 72 >ref|XP_009628067.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana tomentosiformis] gi|698434433|ref|XP_009798962.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana sylvestris] Length = 77 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 248 SAVAQFVKEWGTWTMQKTRVVTYYGFIPMVIIIGMNSEPKPQLYQ 114 + V +FVKEWGTWT +K +V+T+YGFIP+VIIIGMNSEPKP L Q Sbjct: 28 AVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQ 72