BLASTX nr result
ID: Ziziphus21_contig00007851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00007851 (253 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099638.1| Nuclear receptor corepressor 1 [Morus notabi... 66 1e-08 >ref|XP_010099638.1| Nuclear receptor corepressor 1 [Morus notabilis] gi|587891481|gb|EXB80104.1| Nuclear receptor corepressor 1 [Morus notabilis] Length = 1731 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/80 (47%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = -3 Query: 251 PAETLNM-QTALRPEENNRREQVDRKDDG-AQEMTLSDVCHTEDRPKLVSDSDSNTLNGV 78 P ETLN T R E N RE +D K + E SD C T+ RP +VSD DSN NGV Sbjct: 1148 PIETLNSPNTVSRSEGENERELLDHKQNARTSESHGSDACQTQGRPNVVSDGDSNITNGV 1207 Query: 77 DRQSEPLSVQRSEIMFVNRD 18 D QSE L ++ SE + V D Sbjct: 1208 DEQSETLPLRESESVLVTMD 1227