BLASTX nr result
ID: Ziziphus21_contig00007615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00007615 (264 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010092264.1| hypothetical protein L484_005554 [Morus nota... 66 1e-08 ref|XP_008242770.1| PREDICTED: uncharacterized protein LOC103341... 57 4e-06 ref|XP_007202749.1| hypothetical protein PRUPE_ppa013268mg [Prun... 57 4e-06 >ref|XP_010092264.1| hypothetical protein L484_005554 [Morus notabilis] gi|587860985|gb|EXB50854.1| hypothetical protein L484_005554 [Morus notabilis] Length = 128 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = -2 Query: 140 MASSLSLVSVCSYKPSNKPGVFIGNSVPGKVLRTNEVIPSSKPSKF 3 MASSL V S KPS KPG+FIGNSVPGKVLR NEV+ SK SKF Sbjct: 1 MASSLCFTPVSSLKPSKKPGLFIGNSVPGKVLRANEVLQHSKASKF 46 >ref|XP_008242770.1| PREDICTED: uncharacterized protein LOC103341068 [Prunus mume] Length = 131 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 140 MASSLSLVSVCSYKPSNKPGVFIGNSVPGKVLRTNEVIPSSKPSKF 3 MASSLS VCS+K +NKP V I NS+ GKVLR NEV +SK + F Sbjct: 1 MASSLSFTPVCSFKSTNKPRVLIDNSIGGKVLRANEVFQNSKAANF 46 >ref|XP_007202749.1| hypothetical protein PRUPE_ppa013268mg [Prunus persica] gi|462398280|gb|EMJ03948.1| hypothetical protein PRUPE_ppa013268mg [Prunus persica] Length = 131 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 140 MASSLSLVSVCSYKPSNKPGVFIGNSVPGKVLRTNEVIPSSKPSKF 3 MASSLS VCS+K +NKP V I NS+ GKVLR NEV +SK + F Sbjct: 1 MASSLSFTPVCSFKSTNKPRVLIDNSIGGKVLRANEVFQNSKAANF 46