BLASTX nr result
ID: Ziziphus21_contig00006431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00006431 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03793.1| unnamed protein product [Coffea canephora] 60 8e-11 >emb|CDP03793.1| unnamed protein product [Coffea canephora] Length = 439 Score = 60.5 bits (145), Expect(2) = 8e-11 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 156 FQCYACRCLLIFLTIYLSS*EGPSFHI*GASLFR 257 FQCYACRC+LIFLTIYLS +GP FHI GASLF+ Sbjct: 18 FQCYACRCVLIFLTIYLSGKDGPFFHIRGASLFQ 51 Score = 32.7 bits (73), Expect(2) = 8e-11 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 40 MGLRFGFLEDKYFKPSFVTC 99 MGL F F++ KYFKPSF C Sbjct: 1 MGLPFAFIKAKYFKPSFFQC 20