BLASTX nr result
ID: Ziziphus21_contig00006243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00006243 (274 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011657593.1| PREDICTED: BEL1-like homeodomain protein 1 [... 57 4e-06 >ref|XP_011657593.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis sativus] gi|700192846|gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus] Length = 698 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 152 KYLKAVQEILDEVINVGKEITKPTNSSEIGTKQKMKMNRESTPTNGGSSS 3 KYLKA QE+LDEV++VGK K T+ GTK KMKM REST T GG SS Sbjct: 199 KYLKAAQELLDEVVHVGKANFK-TDKFGDGTKDKMKMKRESTTTIGGGSS 247