BLASTX nr result
ID: Ziziphus21_contig00005900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00005900 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876617.1| hypothetical protein ARALYDRAFT_486626 [Arab... 57 7e-06 >ref|XP_002876617.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. lyrata] gi|297322455|gb|EFH52876.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. lyrata] Length = 1127 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 177 KCYSSFILSDRMTKQLSTVRELSIMTAKSHPASMRFIPDQ 296 K Y S ++ QLSTVRELSIMTAKSHPA+MRF+PDQ Sbjct: 570 KIYGELTPSSKVDLQLSTVRELSIMTAKSHPAAMRFVPDQ 609