BLASTX nr result
ID: Ziziphus21_contig00005898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00005898 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205331.1| hypothetical protein PRUPE_ppa006992mg [Prun... 103 7e-20 ref|XP_008222094.1| PREDICTED: transcription initiation factor I... 102 9e-20 ref|XP_009375942.1| PREDICTED: transcription initiation factor I... 102 1e-19 ref|XP_009364352.1| PREDICTED: transcription initiation factor I... 102 1e-19 ref|XP_009364351.1| PREDICTED: transcription initiation factor I... 102 1e-19 ref|XP_008384920.1| PREDICTED: transcription initiation factor I... 101 3e-19 ref|XP_008344834.1| PREDICTED: transcription initiation factor I... 100 3e-19 ref|XP_008344833.1| PREDICTED: transcription initiation factor I... 100 3e-19 ref|XP_010106542.1| Transcription initiation factor IIA large su... 98 2e-18 gb|KGN47124.1| hypothetical protein Csa_6G188660 [Cucumis sativus] 94 5e-17 ref|XP_008464086.1| PREDICTED: transcription initiation factor I... 94 5e-17 ref|XP_008464085.1| PREDICTED: transcription initiation factor I... 94 5e-17 ref|XP_004143132.1| PREDICTED: transcription initiation factor I... 94 5e-17 ref|XP_004294662.1| PREDICTED: transcription initiation factor I... 90 8e-16 ref|XP_010475508.1| PREDICTED: transcription initiation factor I... 89 1e-15 ref|XP_010475506.1| PREDICTED: transcription initiation factor I... 89 1e-15 ref|XP_010457931.1| PREDICTED: transcription initiation factor I... 89 1e-15 ref|XP_010457928.1| PREDICTED: transcription initiation factor I... 89 1e-15 ref|XP_010487504.1| PREDICTED: transcription initiation factor I... 89 1e-15 ref|XP_010487493.1| PREDICTED: transcription initiation factor I... 89 1e-15 >ref|XP_007205331.1| hypothetical protein PRUPE_ppa006992mg [Prunus persica] gi|462400973|gb|EMJ06530.1| hypothetical protein PRUPE_ppa006992mg [Prunus persica] Length = 386 Score = 103 bits (256), Expect = 7e-20 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYVSVIEDVINKVREEF+N+GPGEDVLKELQGTWEAKMMQAGVVN PI+R Sbjct: 1 MATSTSSVYVSVIEDVINKVREEFMNSGPGEDVLKELQGTWEAKMMQAGVVNTPIER 57 >ref|XP_008222094.1| PREDICTED: transcription initiation factor IIA large subunit-like [Prunus mume] Length = 386 Score = 102 bits (255), Expect = 9e-20 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYVSVIEDVINKVREEF+N+GPGEDVLKELQGTWEAKMMQAGVVN PI+R Sbjct: 1 MATSTSSVYVSVIEDVINKVREEFMNSGPGEDVLKELQGTWEAKMMQAGVVNAPIER 57 >ref|XP_009375942.1| PREDICTED: transcription initiation factor IIA large subunit [Pyrus x bretschneideri] Length = 387 Score = 102 bits (254), Expect = 1e-19 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYV+VIEDVINKVREEF+NNGPGEDVLKELQGTWEAK MQAGVVN+PI+R Sbjct: 1 MAASTSSVYVNVIEDVINKVREEFMNNGPGEDVLKELQGTWEAKTMQAGVVNNPIER 57 >ref|XP_009364352.1| PREDICTED: transcription initiation factor IIA large subunit-like isoform X2 [Pyrus x bretschneideri] Length = 383 Score = 102 bits (253), Expect = 1e-19 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYVSVIEDVINKVREEF+NNGPGEDVLKELQGTWEAK +QAGVVN+PI+R Sbjct: 1 MAASTSSVYVSVIEDVINKVREEFMNNGPGEDVLKELQGTWEAKTVQAGVVNNPIER 57 >ref|XP_009364351.1| PREDICTED: transcription initiation factor IIA large subunit-like isoform X1 [Pyrus x bretschneideri] Length = 387 Score = 102 bits (253), Expect = 1e-19 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYVSVIEDVINKVREEF+NNGPGEDVLKELQGTWEAK +QAGVVN+PI+R Sbjct: 1 MAASTSSVYVSVIEDVINKVREEFMNNGPGEDVLKELQGTWEAKTVQAGVVNNPIER 57 >ref|XP_008384920.1| PREDICTED: transcription initiation factor IIA large subunit [Malus domestica] Length = 387 Score = 101 bits (251), Expect = 3e-19 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSSVYVSVIEDVINKVREEF+NNGPGEDVLKELQG WEAK MQAGVVN+PI+R Sbjct: 1 MAASTSSVYVSVIEDVINKVREEFMNNGPGEDVLKELQGIWEAKTMQAGVVNNPIER 57 >ref|XP_008344834.1| PREDICTED: transcription initiation factor IIA large subunit-like isoform X2 [Malus domestica] Length = 369 Score = 100 bits (250), Expect = 3e-19 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TS VYVSVIEDVINKVREEF+NNGPGEDVLKELQGTWEAK +QAGVVN+PI+R Sbjct: 1 MAASTSGVYVSVIEDVINKVREEFLNNGPGEDVLKELQGTWEAKTVQAGVVNNPIER 57 >ref|XP_008344833.1| PREDICTED: transcription initiation factor IIA large subunit-like isoform X1 [Malus domestica] Length = 387 Score = 100 bits (250), Expect = 3e-19 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TS VYVSVIEDVINKVREEF+NNGPGEDVLKELQGTWEAK +QAGVVN+PI+R Sbjct: 1 MAASTSGVYVSVIEDVINKVREEFLNNGPGEDVLKELQGTWEAKTVQAGVVNNPIER 57 >ref|XP_010106542.1| Transcription initiation factor IIA large subunit [Morus notabilis] gi|587923368|gb|EXC10718.1| Transcription initiation factor IIA large subunit [Morus notabilis] Length = 404 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TS+VYVSVIEDVI+KVR+EFINNGPGEDVLKELQG WEAKMM AGVVN PI+R Sbjct: 1 MATSTSAVYVSVIEDVISKVRDEFINNGPGEDVLKELQGMWEAKMMHAGVVNSPIER 57 >gb|KGN47124.1| hypothetical protein Csa_6G188660 [Cucumis sativus] Length = 536 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSS+Y++VIEDVINK+R+EF++NGPGEDVLKELQG WEAKMMQAG V PI+R Sbjct: 135 MATSTSSIYINVIEDVINKLRDEFVDNGPGEDVLKELQGMWEAKMMQAGAVTGPIER 191 >ref|XP_008464086.1| PREDICTED: transcription initiation factor IIA large subunit isoform X2 [Cucumis melo] Length = 366 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSS+Y++VIEDVINK+R+EF++NGPGEDVLKELQG WEAKMMQAG V PI+R Sbjct: 1 MATSTSSIYINVIEDVINKLRDEFVDNGPGEDVLKELQGMWEAKMMQAGAVTGPIER 57 >ref|XP_008464085.1| PREDICTED: transcription initiation factor IIA subunit 1 isoform X1 [Cucumis melo] Length = 401 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSS+Y++VIEDVINK+R+EF++NGPGEDVLKELQG WEAKMMQAG V PI+R Sbjct: 1 MATSTSSIYINVIEDVINKLRDEFVDNGPGEDVLKELQGMWEAKMMQAGAVTGPIER 57 >ref|XP_004143132.1| PREDICTED: transcription initiation factor IIA subunit 1 [Cucumis sativus] Length = 402 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -3 Query: 172 MTSLTSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 M + TSS+Y++VIEDVINK+R+EF++NGPGEDVLKELQG WEAKMMQAG V PI+R Sbjct: 1 MATSTSSIYINVIEDVINKLRDEFVDNGPGEDVLKELQGMWEAKMMQAGAVTGPIER 57 >ref|XP_004294662.1| PREDICTED: transcription initiation factor IIA large subunit-like [Fragaria vesca subsp. vesca] Length = 377 Score = 89.7 bits (221), Expect = 8e-16 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 160 TSSVYVSVIEDVINKVREEFINNGPGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 TS+VY+SVIEDVINKV+EEF N G GEDVLKELQGTWEAKMMQAGVVN PI+R Sbjct: 4 TSAVYISVIEDVINKVKEEFAN-GAGEDVLKELQGTWEAKMMQAGVVNAPIER 55 >ref|XP_010475508.1| PREDICTED: transcription initiation factor IIA large subunit-like [Camelina sativa] Length = 375 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60 >ref|XP_010475506.1| PREDICTED: transcription initiation factor IIA large subunit-like [Camelina sativa] Length = 375 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60 >ref|XP_010457931.1| PREDICTED: transcription initiation factor IIA large subunit-like [Camelina sativa] Length = 378 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60 >ref|XP_010457928.1| PREDICTED: transcription initiation factor IIA large subunit-like [Camelina sativa] Length = 378 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60 >ref|XP_010487504.1| PREDICTED: transcription initiation factor IIA large subunit-like isoform X1 [Camelina sativa] Length = 376 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60 >ref|XP_010487493.1| PREDICTED: transcription initiation factor IIA large subunit-like [Camelina sativa] Length = 375 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = -3 Query: 169 TSLTSSVYVSVIEDVINKVREEFINNG-PGEDVLKELQGTWEAKMMQAGVVNDPIDR 2 T+ TS+VY+ VIEDV+NKVREEFINNG PGE VL ELQG WE KMMQAGV+N PI+R Sbjct: 4 TTTTSAVYIQVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER 60