BLASTX nr result
ID: Ziziphus21_contig00004546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00004546 (557 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32777.3| unnamed protein product [Vitis vinifera] 68 3e-09 ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vin... 68 3e-09 emb|CAN74410.1| hypothetical protein VITISV_013215 [Vitis vinifera] 68 3e-09 emb|CDP06773.1| unnamed protein product [Coffea canephora] 67 6e-09 gb|ACE60601.1| mannan synthase [Coffea arabica] 67 6e-09 gb|ACE60600.1| mannan synthase [Coffea canephora] 67 6e-09 ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2... 67 7e-09 ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1... 67 7e-09 ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2... 67 7e-09 ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1... 67 7e-09 ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum t... 67 7e-09 ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum l... 67 7e-09 ref|XP_011620523.1| PREDICTED: mannan synthase 1 [Amborella tric... 65 2e-08 gb|ERM98506.1| hypothetical protein AMTR_s00072p00194730 [Ambore... 65 2e-08 ref|XP_010096071.1| hypothetical protein L484_000910 [Morus nota... 65 2e-08 gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythra... 65 2e-08 ref|XP_011094610.1| PREDICTED: mannan synthase 1-like [Sesamum i... 64 4e-08 sp|Q6UDF0.1|CSLA1_CYATE RecName: Full=Mannan synthase 1; AltName... 64 4e-08 ref|XP_009385870.1| PREDICTED: mannan synthase 1-like [Musa acum... 64 5e-08 ref|XP_004493996.1| PREDICTED: mannan synthase 1 [Cicer arietinum] 64 6e-08 >emb|CBI32777.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKMTKEI+LCE Sbjct: 268 FKAYRYQQHRWSCGPANLFRKMTKEIILCE 297 >ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vinifera] Length = 526 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKMTKEI+LCE Sbjct: 314 FKAYRYQQHRWSCGPANLFRKMTKEIILCE 343 >emb|CAN74410.1| hypothetical protein VITISV_013215 [Vitis vinifera] Length = 529 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKMTKEI+LCE Sbjct: 314 FKAYRYQQHRWSCGPANLFRKMTKEIILCE 343 >emb|CDP06773.1| unnamed protein product [Coffea canephora] Length = 530 Score = 67.0 bits (162), Expect = 6e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEILLCE Sbjct: 316 FKAYRFQQHRWSCGPANLFRKMFKEILLCE 345 >gb|ACE60601.1| mannan synthase [Coffea arabica] Length = 530 Score = 67.0 bits (162), Expect = 6e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEILLCE Sbjct: 316 FKAYRFQQHRWSCGPANLFRKMFKEILLCE 345 >gb|ACE60600.1| mannan synthase [Coffea canephora] Length = 530 Score = 67.0 bits (162), Expect = 6e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEILLCE Sbjct: 316 FKAYRFQQHRWSCGPANLFRKMFKEILLCE 345 >ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris] Length = 527 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMMKEIMLCE 343 >ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMMKEIMLCE 343 >ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis] Length = 527 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMMKEIMLCE 343 >ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMMKEIMLCE 343 >ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum] Length = 527 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMIKEIILCE 343 >ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum] Length = 527 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRFQQHRWSCGPANLFRKMIKEIILCE 343 >ref|XP_011620523.1| PREDICTED: mannan synthase 1 [Amborella trichopoda] Length = 482 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKM KEI+LCE Sbjct: 269 FKAYRYQQHRWSCGPANLFRKMIKEIILCE 298 >gb|ERM98506.1| hypothetical protein AMTR_s00072p00194730 [Amborella trichopoda] Length = 327 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKM KEI+LCE Sbjct: 231 FKAYRYQQHRWSCGPANLFRKMIKEIILCE 260 >ref|XP_010096071.1| hypothetical protein L484_000910 [Morus notabilis] gi|587956706|gb|EXC42303.1| hypothetical protein L484_000910 [Morus notabilis] Length = 527 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAY +QQHRWSCGPANLFRKMTKEI+LCE Sbjct: 314 FKAYLYQQHRWSCGPANLFRKMTKEIILCE 343 >gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythranthe guttata] Length = 527 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKM KEI+LCE Sbjct: 314 FKAYRYQQHRWSCGPANLFRKMFKEIILCE 343 >ref|XP_011094610.1| PREDICTED: mannan synthase 1-like [Sesamum indicum] Length = 527 Score = 64.3 bits (155), Expect = 4e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYR+QQHRWSCGPANLFRKM KEI++CE Sbjct: 314 FKAYRYQQHRWSCGPANLFRKMFKEIIICE 343 >sp|Q6UDF0.1|CSLA1_CYATE RecName: Full=Mannan synthase 1; AltName: Full=CtManS [Cyamopsis tetragonoloba] gi|38532106|gb|AAR23313.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba] gi|294874880|gb|ADF47159.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba] Length = 526 Score = 64.3 bits (155), Expect = 4e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLF+KMTKEI+ C+ Sbjct: 313 FKAYRFQQHRWSCGPANLFKKMTKEIICCK 342 >ref|XP_009385870.1| PREDICTED: mannan synthase 1-like [Musa acuminata subsp. malaccensis] Length = 526 Score = 63.9 bits (154), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANLFRKM KEIL C+ Sbjct: 313 FKAYRFQQHRWSCGPANLFRKMLKEILCCK 342 >ref|XP_004493996.1| PREDICTED: mannan synthase 1 [Cicer arietinum] Length = 527 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 90 FKAYRFQQHRWSCGPANLFRKMTKEILLCE 1 FKAYRFQQHRWSCGPANL +KMTKEIL C+ Sbjct: 312 FKAYRFQQHRWSCGPANLLKKMTKEILFCQ 341