BLASTX nr result
ID: Ziziphus21_contig00003565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00003565 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112164.1| hypothetical protein L484_019903 [Morus nota... 65 2e-08 >ref|XP_010112164.1| hypothetical protein L484_019903 [Morus notabilis] gi|587946450|gb|EXC32789.1| hypothetical protein L484_019903 [Morus notabilis] Length = 537 Score = 65.1 bits (157), Expect = 2e-08 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 3/84 (3%) Frame = -1 Query: 243 IQKLRIKS---DGDDTKVLAPTAPYTDDAKVSAPSKKRKPNEKTTMVSDGKLTKESAIWS 73 +Q+ R KS DG+ + ++ P D + PSKK KP EKTTM+S+GKL KE + S Sbjct: 449 MQQPRFKSAANDGETSLTVSALKPSKDSTE-KGPSKKLKPEEKTTMLSNGKLIKEPSQKS 507 Query: 72 QHQNHKIDGPELEVTRRPQADKSK 1 +++HK DG +LEVT P A SK Sbjct: 508 HNEDHKTDGQKLEVTPSPHALSSK 531