BLASTX nr result
ID: Ziziphus21_contig00003356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00003356 (526 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523078.1| conserved hypothetical protein [Ricinus comm... 61 3e-07 ref|XP_010106376.1| Pre-mRNA-splicing factor SF2 [Morus notabili... 61 4e-07 >ref|XP_002523078.1| conserved hypothetical protein [Ricinus communis] gi|223537640|gb|EEF39263.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 40 GDLDLERDLQKFQKQPI*IPHVPL-TKFDPRSLMPLPRQSYQIQ 168 GDLDLERDLQKFQKQP H L F PR+LMPLPRQSYQIQ Sbjct: 10 GDLDLERDLQKFQKQPKFKIHTFLFNNFHPRALMPLPRQSYQIQ 53 >ref|XP_010106376.1| Pre-mRNA-splicing factor SF2 [Morus notabilis] gi|587922920|gb|EXC10292.1| Pre-mRNA-splicing factor SF2 [Morus notabilis] Length = 389 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -1 Query: 526 DWGQRSSWITI*ELDNCVLSAIGIWKSPSICSRD 425 DW QR SWI I ELDNCVLSAIGIWKSPS CSRD Sbjct: 299 DWEQRRSWIAIVELDNCVLSAIGIWKSPS-CSRD 331