BLASTX nr result
ID: Ziziphus21_contig00003267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00003267 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384420.1| PREDICTED: 60S ribosomal protein L29-1-like ... 115 2e-23 gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] 115 2e-23 ref|XP_010094315.1| 60S ribosomal protein L29-1 [Morus notabilis... 114 2e-23 ref|XP_010268018.1| PREDICTED: 60S ribosomal protein L29-1-like ... 114 4e-23 ref|XP_008458371.1| PREDICTED: 60S ribosomal protein L29-1-like ... 114 4e-23 ref|XP_003609753.2| 60S ribosomal protein L29-1 [Medicago trunca... 114 4e-23 gb|KJB72799.1| hypothetical protein B456_011G198800 [Gossypium r... 113 5e-23 ref|XP_009800219.1| PREDICTED: 60S ribosomal protein L29-1-like ... 113 6e-23 ref|XP_009607972.1| PREDICTED: 60S ribosomal protein L29-1-like ... 113 6e-23 emb|CDO98785.1| unnamed protein product [Coffea canephora] 112 8e-23 ref|XP_012084042.1| PREDICTED: 60S ribosomal protein L29-1 [Jatr... 112 8e-23 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 112 8e-23 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 112 8e-23 ref|XP_010558440.1| PREDICTED: 60S ribosomal protein L29-1-like ... 112 1e-22 ref|XP_010024783.1| PREDICTED: 60S ribosomal protein L29-1-like ... 112 1e-22 ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, part... 112 1e-22 ref|XP_008458370.1| PREDICTED: 60S ribosomal protein L29-1 [Cucu... 111 2e-22 gb|KNA15842.1| hypothetical protein SOVF_094520 [Spinacia oleracea] 111 2e-22 ref|XP_010259336.1| PREDICTED: 60S ribosomal protein L29-1-like ... 111 2e-22 ref|XP_009789604.1| PREDICTED: 60S ribosomal protein L29-1-like ... 111 2e-22 >ref|XP_009384420.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] gi|695074438|ref|XP_009384421.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] Length = 62 Score = 115 bits (287), Expect = 2e-23 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 52 >gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 115 bits (287), Expect = 2e-23 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 52 >ref|XP_010094315.1| 60S ribosomal protein L29-1 [Morus notabilis] gi|587866257|gb|EXB55735.1| 60S ribosomal protein L29-1 [Morus notabilis] Length = 61 Score = 114 bits (286), Expect = 2e-23 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQN 43 MAKSKNHTAHNQS+KAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNN++N Sbjct: 1 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNQKN 54 >ref|XP_010268018.1| PREDICTED: 60S ribosomal protein L29-1-like [Nelumbo nucifera] Length = 111 Score = 114 bits (284), Expect = 4e-23 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -3 Query: 216 FFLEMAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 F EMAKSKNHTAHNQSYKAHKNGIKKPR+HR TSTKGMDPKFLRNQRYARKHNNK Sbjct: 46 FLREMAKSKNHTAHNQSYKAHKNGIKKPRRHRKTSTKGMDPKFLRNQRYARKHNNK 101 >ref|XP_008458371.1| PREDICTED: 60S ribosomal protein L29-1-like [Cucumis melo] Length = 61 Score = 114 bits (284), Expect = 4e-23 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYA+KHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNK 52 >ref|XP_003609753.2| 60S ribosomal protein L29-1 [Medicago truncatula] gi|657390953|gb|AES91950.2| 60S ribosomal protein L29-1 [Medicago truncatula] Length = 197 Score = 114 bits (284), Expect = 4e-23 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 210 LEMAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 LEMAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K Sbjct: 135 LEMAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKK 188 >gb|KJB72799.1| hypothetical protein B456_011G198800 [Gossypium raimondii] Length = 146 Score = 113 bits (283), Expect = 5e-23 Identities = 53/58 (91%), Positives = 55/58 (94%), Gaps = 2/58 (3%) Frame = -3 Query: 216 FFL--EMAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 FFL EMAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K Sbjct: 80 FFLASEMAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKK 137 >ref|XP_009800219.1| PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] Length = 61 Score = 113 bits (282), Expect = 6e-23 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQN 43 MAKSKNHTAHNQSYKAH+NGIKKPRKHRH+STKGMDPKFLRNQRYARKHNN +N Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNNNKN 54 >ref|XP_009607972.1| PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tomentosiformis] Length = 61 Score = 113 bits (282), Expect = 6e-23 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQN 43 MAKSKNHTAHNQSYKAH+NGIKKPRKHRH+STKGMDPKFLRNQRYARKHNN +N Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNNNKN 54 >emb|CDO98785.1| unnamed protein product [Coffea canephora] Length = 61 Score = 112 bits (281), Expect = 8e-23 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNKK 52 >ref|XP_012084042.1| PREDICTED: 60S ribosomal protein L29-1 [Jatropha curcas] gi|802703291|ref|XP_012084043.1| PREDICTED: 60S ribosomal protein L29-1 [Jatropha curcas] gi|643716120|gb|KDP27893.1| hypothetical protein JCGZ_18973 [Jatropha curcas] Length = 61 Score = 112 bits (281), Expect = 8e-23 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNK 52 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like [Cicer arietinum] gi|828310279|ref|XP_012571028.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X4 [Cicer arietinum] Length = 61 Score = 112 bits (281), Expect = 8e-23 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNK 52 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 112 bits (281), Expect = 8e-23 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNKK 52 >ref|XP_010558440.1| PREDICTED: 60S ribosomal protein L29-1-like [Tarenaya hassleriana] Length = 61 Score = 112 bits (279), Expect = 1e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQS+KAHKNGIKKPR+HRHTSTKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSHKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNK 52 >ref|XP_010024783.1| PREDICTED: 60S ribosomal protein L29-1-like [Eucalyptus grandis] gi|702446940|ref|XP_010024784.1| PREDICTED: 60S ribosomal protein L29-1-like [Eucalyptus grandis] Length = 60 Score = 112 bits (279), Expect = 1e-22 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQ 46 MAKSKNHTAHNQSYKAHKNGIKKPR+HRHTSTKGMDPKFLRNQRYARKHN K+ Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNQKK 53 >ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] gi|557521291|gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 112 bits (279), Expect = 1e-22 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 207 EMAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 EMAKSKNHTAHNQSYKAHKNGIKKP+KHRHTSTKGMDPKFLRNQRYARKHN + Sbjct: 28 EMAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQ 80 >ref|XP_008458370.1| PREDICTED: 60S ribosomal protein L29-1 [Cucumis melo] Length = 61 Score = 111 bits (278), Expect = 2e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYA+KHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNTK 52 >gb|KNA15842.1| hypothetical protein SOVF_094520 [Spinacia oleracea] Length = 61 Score = 111 bits (277), Expect = 2e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQSYKAHKNGIKKPRKHRH+STKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNKK 52 >ref|XP_010259336.1| PREDICTED: 60S ribosomal protein L29-1-like [Nelumbo nucifera] Length = 62 Score = 111 bits (277), Expect = 2e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 49 MAKSKNHTAHNQS+KAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNKK 52 >ref|XP_009789604.1| PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] gi|698485670|ref|XP_009789605.1| PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] Length = 61 Score = 111 bits (277), Expect = 2e-22 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -3 Query: 204 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKQN 43 MAKSKNHTAHNQSYKAH+NGIKKPRKHRH+STKGMDPKFLRNQRYARKHNN ++ Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNNNKS 54