BLASTX nr result
ID: Ziziphus21_contig00002046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00002046 (210 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39757.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002266273.1| PREDICTED: cellulose synthase-like protein E... 64 3e-08 emb|CAN62860.1| hypothetical protein VITISV_036212 [Vitis vinifera] 64 3e-08 ref|XP_004148922.2| PREDICTED: cellulose synthase-like protein E... 63 8e-08 ref|XP_008463016.1| PREDICTED: cellulose synthase-like protein E... 62 2e-07 ref|XP_010092349.1| Cellulose synthase-like protein E6 [Morus no... 58 2e-06 ref|XP_009349150.1| PREDICTED: uncharacterized protein LOC103940... 58 3e-06 gb|KDO59154.1| hypothetical protein CISIN_1g009753mg [Citrus sin... 58 3e-06 ref|XP_006474851.1| PREDICTED: cellulose synthase-like protein E... 58 3e-06 ref|XP_006452624.1| hypothetical protein CICLE_v10007586mg [Citr... 58 3e-06 ref|XP_006452623.1| hypothetical protein CICLE_v10007586mg [Citr... 58 3e-06 ref|XP_010092347.1| Cellulose synthase-like protein E1 [Morus no... 57 4e-06 gb|KHG13946.1| Cellulose synthase-like protein E6 [Gossypium arb... 57 7e-06 >emb|CBI39757.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 A+E G IPKE RDQHKGFSEWD ITK++HQSIVQ++ Sbjct: 152 AVEVGSIPKEVRDQHKGFSEWDSKITKKDHQSIVQIL 188 >ref|XP_002266273.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera] Length = 736 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 A+E G IPKE RDQHKGFSEWD ITK++HQSIVQ++ Sbjct: 213 AVEVGSIPKEVRDQHKGFSEWDSKITKKDHQSIVQIL 249 >emb|CAN62860.1| hypothetical protein VITISV_036212 [Vitis vinifera] Length = 718 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 A+E G IPKE RDQHKGFSEWD ITK++HQSIVQ++ Sbjct: 209 AVEVGSIPKEVRDQHKGFSEWDSKITKKDHQSIVQIL 245 >ref|XP_004148922.2| PREDICTED: cellulose synthase-like protein E6 [Cucumis sativus] gi|700188806|gb|KGN44039.1| hypothetical protein Csa_7G129380 [Cucumis sativus] Length = 741 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 205 IETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVMF 95 +E G++PKE RDQ+KGFSEWD ITKQNHQSIV+++F Sbjct: 216 VEMGRVPKEIRDQNKGFSEWDNGITKQNHQSIVKIIF 252 >ref|XP_008463016.1| PREDICTED: cellulose synthase-like protein E6 [Cucumis melo] Length = 741 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 205 IETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 +E GK+PKE RDQ+KGFSEWD ITKQNHQSIV+++ Sbjct: 216 VEMGKVPKEIRDQNKGFSEWDNGITKQNHQSIVKII 251 >ref|XP_010092349.1| Cellulose synthase-like protein E6 [Morus notabilis] gi|587861165|gb|EXB51025.1| Cellulose synthase-like protein E6 [Morus notabilis] Length = 748 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 A+E GK+P+E R QHKGFSEW+ NI K +HQ IVQ++ Sbjct: 227 AVEAGKVPEEARKQHKGFSEWNLNIKKNDHQPIVQIL 263 >ref|XP_009349150.1| PREDICTED: uncharacterized protein LOC103940710 [Pyrus x bretschneideri] Length = 1472 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 A+ETGKIP+ET+ QHKGFSEW+ + K +HQ IVQ++ Sbjct: 218 AVETGKIPEETKMQHKGFSEWNLKVAKNDHQPIVQII 254 >gb|KDO59154.1| hypothetical protein CISIN_1g009753mg [Citrus sinensis] Length = 526 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 AI G I KETR+QHKGFSEW+ +TKQ+HQSIVQ++ Sbjct: 8 AIAKGSISKETRNQHKGFSEWNCKVTKQDHQSIVQII 44 >ref|XP_006474851.1| PREDICTED: cellulose synthase-like protein E6-like isoform X1 [Citrus sinensis] Length = 727 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 AI G I KETR+QHKGFSEW+ +TKQ+HQSIVQ++ Sbjct: 209 AIAKGSISKETRNQHKGFSEWNCKVTKQDHQSIVQII 245 >ref|XP_006452624.1| hypothetical protein CICLE_v10007586mg [Citrus clementina] gi|557555850|gb|ESR65864.1| hypothetical protein CICLE_v10007586mg [Citrus clementina] Length = 727 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 AI G I KETR+QHKGFSEW+ +TKQ+HQSIVQ++ Sbjct: 209 AIAKGSISKETRNQHKGFSEWNCKVTKQDHQSIVQII 245 >ref|XP_006452623.1| hypothetical protein CICLE_v10007586mg [Citrus clementina] gi|557555849|gb|ESR65863.1| hypothetical protein CICLE_v10007586mg [Citrus clementina] Length = 526 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 208 AIETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 AI G I KETR+QHKGFSEW+ +TKQ+HQSIVQ++ Sbjct: 8 AIAKGSISKETRNQHKGFSEWNCKVTKQDHQSIVQII 44 >ref|XP_010092347.1| Cellulose synthase-like protein E1 [Morus notabilis] gi|587861163|gb|EXB51023.1| Cellulose synthase-like protein E1 [Morus notabilis] Length = 577 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 205 IETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 I+ GK+P+ETR +HKGFSEW+ NI K +HQSIVQ++ Sbjct: 199 IKLGKVPQETRKRHKGFSEWNLNIKKNDHQSIVQIL 234 >gb|KHG13946.1| Cellulose synthase-like protein E6 [Gossypium arboreum] Length = 530 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -3 Query: 205 IETGKIPKETRDQHKGFSEWDFNITKQNHQSIVQVM 98 I G +P+E +QHKGFSEWD N+TKQNHQ IVQ++ Sbjct: 9 INKGGVPEELMNQHKGFSEWDSNVTKQNHQPIVQII 44