BLASTX nr result
ID: Ziziphus21_contig00001782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00001782 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219980.1| hypothetical protein PRUPE_ppb021447mg, part... 61 3e-07 >ref|XP_007219980.1| hypothetical protein PRUPE_ppb021447mg, partial [Prunus persica] gi|462416442|gb|EMJ21179.1| hypothetical protein PRUPE_ppb021447mg, partial [Prunus persica] Length = 730 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -3 Query: 290 ELKDSCCIEVMVRTQWLGIG--KISYVDIHNELAYGFGLSWVRSFAEKGDLASKCHIN 123 +L + C IE+MVRT W G +SY+DIHNEL YGF LSW++S+ ++G S C++N Sbjct: 315 DLTELCRIELMVRTSWPGTKGTNLSYIDIHNELVYGFELSWLQSY-DRGRKGSICYVN 371