BLASTX nr result
ID: Ziziphus21_contig00001596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00001596 (594 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009365457.1| PREDICTED: uncharacterized protein LOC103955... 72 2e-10 ref|XP_012088816.1| PREDICTED: hydrophobic protein LTI6B-like [J... 69 2e-09 ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumb... 66 1e-08 ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa a... 66 2e-08 ref|XP_009335544.1| PREDICTED: hydrophobic protein LTI6B-like [P... 65 2e-08 ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [P... 65 2e-08 ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoeni... 65 3e-08 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 65 3e-08 gb|KQL03570.1| hypothetical protein SETIT_003690mg [Setaria ital... 65 3e-08 gb|KQL03568.1| hypothetical protein SETIT_003690mg [Setaria ital... 64 8e-08 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 64 8e-08 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 64 8e-08 ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamu... 63 1e-07 ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa a... 63 1e-07 ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [M... 63 1e-07 gb|KQL03565.1| hypothetical protein SETIT_003690mg [Setaria ital... 63 1e-07 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 63 1e-07 ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna ... 62 2e-07 ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|2269... 62 2e-07 ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG2... 62 2e-07 >ref|XP_009365457.1| PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 72.0 bits (175), Expect = 2e-10 Identities = 39/65 (60%), Positives = 45/65 (69%) Frame = -3 Query: 427 AERRHSKMHRYPSGNHLASSRCLPQVWLQG*ILDLSVADSAWLHPWDYLRCLYYSQVIYM 248 AERR+ K+ R+P + LASS LPQVWL ILDL VAD WLHPWDYL L + QV+ Sbjct: 119 AERRNIKLRRHPPRHPLASSWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQVM-- 176 Query: 247 TSNFC 233 SNFC Sbjct: 177 -SNFC 180 >ref|XP_012088816.1| PREDICTED: hydrophobic protein LTI6B-like [Jatropha curcas] gi|257219544|gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] gi|643708412|gb|KDP23328.1| hypothetical protein JCGZ_23161 [Jatropha curcas] Length = 57 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/47 (68%), Positives = 33/47 (70%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 MP EGTA C LGVFLKFGCK EFWICLLLT+LGYIPG Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPG 47 >ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 66.2 bits (160), Expect = 1e-08 Identities = 32/47 (68%), Positives = 32/47 (68%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 M EGTA C LGVFLKFGCKVEFWICLLLTL GYIPG Sbjct: 1 MASEGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYIPG 47 >ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa acuminata subsp. malaccensis] Length = 57 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 M +GTA+C LGVFLKFGCKVEFWICLLLTL GY+PG Sbjct: 1 MANQGTARCIEILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYLPG 47 >ref|XP_009335544.1| PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/47 (65%), Positives = 31/47 (65%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 MP EGT C LGVFLKFGC VEFWICLLLTL GYIPG Sbjct: 1 MPSEGTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLTLFGYIPG 47 >ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] gi|672195925|ref|XP_008776673.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] Length = 57 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 MP EGT C LGVFLKFGCKVEFW+CL+LTL GY+PG Sbjct: 1 MPSEGTVNCIDILLAIILPPLGVFLKFGCKVEFWLCLVLTLFGYLPG 47 >ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] gi|672195917|ref|XP_008776671.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] Length = 57 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/47 (65%), Positives = 32/47 (68%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 M EGTA C LGVFLKFGCK EFWICLLLT+LGYIPG Sbjct: 1 MADEGTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLTILGYIPG 47 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|641837447|gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] gi|641837448|gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/47 (65%), Positives = 32/47 (68%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 M EGTA C LGVFLKFGCKVEFWICLLLT+ GYIPG Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPG 47 >gb|KQL03570.1| hypothetical protein SETIT_003690mg [Setaria italica] gi|944239263|gb|KQL03571.1| hypothetical protein SETIT_003690mg [Setaria italica] Length = 57 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -1 Query: 423 REGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +EGTA C LGVFLKFGCKVEFW+CLLLT LGY+PG Sbjct: 2 KEGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPG 46 >gb|KQL03568.1| hypothetical protein SETIT_003690mg [Setaria italica] gi|944239261|gb|KQL03569.1| hypothetical protein SETIT_003690mg [Setaria italica] Length = 56 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -1 Query: 423 REGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +EGTA C LGVFLKFGCK EFWICLLLT LGY+PG Sbjct: 2 KEGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPG 46 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 63.5 bits (153), Expect = 8e-08 Identities = 31/52 (59%), Positives = 33/52 (63%) Frame = -1 Query: 444 RN*QKMPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +N KM TA C LGVFLKFGCK EFWICLLLT+LGYIPG Sbjct: 42 KNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPG 93 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 63.5 bits (153), Expect = 8e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -1 Query: 423 REGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 REGTA C +GVFLKFGC EFWICLLLT+LGY+PG Sbjct: 2 REGTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTILGYLPG 46 >ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamum indicum] Length = 57 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -1 Query: 420 EGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +GTA C LGVFLKFGCKVEFWICLLLT+ GYIPG Sbjct: 3 DGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPG 46 >ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] gi|695058893|ref|XP_009417777.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] Length = 54 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -1 Query: 417 GTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 GTA C LGVFLKFGCKVEFW+CLLLT+LGYIPG Sbjct: 2 GTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPG 44 >ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 54 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -1 Query: 417 GTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 GTA C LGVFLKFGCKVEFW+CLLLT+LGYIPG Sbjct: 2 GTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPG 44 >gb|KQL03565.1| hypothetical protein SETIT_003690mg [Setaria italica] gi|944239258|gb|KQL03566.1| hypothetical protein SETIT_003690mg [Setaria italica] gi|944239259|gb|KQL03567.1| hypothetical protein SETIT_003690mg [Setaria italica] Length = 56 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = -1 Query: 420 EGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 EGTA C LGVFLKFGCK EFWICLLLT LGY+PG Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPG 46 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -1 Query: 417 GTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 GTA C LGVFL+FGCKVEFWICLLLT+LGYIPG Sbjct: 2 GTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPG 44 >ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] gi|920692191|gb|KOM35416.1| hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = -1 Query: 429 MPREGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 M +GTA C LGVFLK+GCKVEFWICL+LTL GYIPG Sbjct: 1 MAGDGTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPG 47 >ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|226958659|ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays] gi|195648282|gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays] gi|195650163|gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays] gi|414877124|tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -1 Query: 423 REGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +EGTA C LGVFLKFGCKVEFW+CLLLT L Y+PG Sbjct: 2 KEGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLAYLPG 46 >ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays] gi|413946837|gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -1 Query: 423 REGTAKCXXXXXXXXXXXLGVFLKFGCKVEFWICLLLTLLGYIPG 289 +EGTA C LGVFLKFGCKVEFW+CLLLT L Y+PG Sbjct: 2 KEGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLAYLPG 46