BLASTX nr result
ID: Ziziphus21_contig00001567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00001567 (215 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010100837.1| hypothetical protein L484_003853 [Morus nota... 64 2e-08 ref|XP_010558287.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_010558288.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_012443370.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_012443371.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 gb|KHG21135.1| hypothetical protein F383_28297 [Gossypium arboreum] 63 3e-08 ref|XP_007027210.1| Tetratricopeptide repeat (TPR)-like superfam... 62 7e-08 ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containi... 61 9e-08 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 61 9e-08 ref|XP_010037923.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_010037924.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 gb|KCW49699.1| hypothetical protein EUGRSUZ_K03203 [Eucalyptus g... 60 2e-07 ref|XP_009602545.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-07 ref|XP_011004144.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-07 ref|XP_009602546.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-07 ref|XP_006381507.1| pentatricopeptide repeat-containing family p... 59 6e-07 ref|XP_006428907.1| hypothetical protein CICLE_v10011055mg [Citr... 60 6e-07 ref|XP_006367266.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_004246707.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_008447199.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010100837.1| hypothetical protein L484_003853 [Morus notabilis] gi|587896335|gb|EXB84820.1| hypothetical protein L484_003853 [Morus notabilis] Length = 822 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTTVIKVCVE KDLK AF LF EMKRYQIQPNLV N Sbjct: 559 YTTVIKVCVESKDLKQAFELFAEMKRYQIQPNLVTYN 595 Score = 21.6 bits (44), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 592 VTYNTLLRA 600 >ref|XP_010558287.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Tarenaya hassleriana] Length = 872 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K LKLAFSLFEEM+RYQI+PNLV N Sbjct: 603 YTTAIKVCVESKKLKLAFSLFEEMRRYQIKPNLVTYN 639 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 636 VTYNTLLRA 644 >ref|XP_010558288.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Tarenaya hassleriana] Length = 868 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K LKLAFSLFEEM+RYQI+PNLV N Sbjct: 603 YTTAIKVCVESKKLKLAFSLFEEMRRYQIKPNLVTYN 639 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 636 VTYNTLLRA 644 >ref|XP_012443370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Gossypium raimondii] gi|763795524|gb|KJB62520.1| hypothetical protein B456_009G420800 [Gossypium raimondii] Length = 862 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K LKLAFSLFEEMKRY +QPNLV N Sbjct: 593 YTTAIKVCVESKRLKLAFSLFEEMKRYSVQPNLVTYN 629 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 626 VTYNTLLRA 634 >ref|XP_012443371.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Gossypium raimondii] gi|763795523|gb|KJB62519.1| hypothetical protein B456_009G420800 [Gossypium raimondii] Length = 861 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K LKLAFSLFEEMKRY +QPNLV N Sbjct: 592 YTTAIKVCVESKRLKLAFSLFEEMKRYSVQPNLVTYN 628 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 625 VTYNTLLRA 633 >gb|KHG21135.1| hypothetical protein F383_28297 [Gossypium arboreum] Length = 861 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K LKLAFSLFEEMKRY +QPNLV N Sbjct: 592 YTTAIKVCVESKRLKLAFSLFEEMKRYSVQPNLVTYN 628 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 625 VTYNTLLRA 633 >ref|XP_007027210.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508715815|gb|EOY07712.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 858 Score = 61.6 bits (148), Expect(2) = 7e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCV K+LKLAFSLFEEMKRY++QPNLV N Sbjct: 589 YTTAIKVCVGSKNLKLAFSLFEEMKRYRVQPNLVTYN 625 Score = 21.6 bits (44), Expect(2) = 7e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 622 VTYNTLLRA 630 >ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Vitis vinifera] Length = 852 Score = 61.2 bits (147), Expect(2) = 9e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IK CVE K+LK+AFSLF EMKRYQIQPNLV N Sbjct: 582 YTTAIKYCVESKNLKIAFSLFAEMKRYQIQPNLVTYN 618 Score = 21.6 bits (44), Expect(2) = 9e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 615 VTYNTLLRA 623 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Length = 842 Score = 61.2 bits (147), Expect(2) = 9e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IK CVE K+LK+AFSLF EMKRYQIQPNLV N Sbjct: 572 YTTAIKYCVESKNLKIAFSLFAEMKRYQIQPNLVTYN 608 Score = 21.6 bits (44), Expect(2) = 9e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 605 VTYNTLLRA 613 >ref|XP_010037923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Eucalyptus grandis] Length = 822 Score = 60.1 bits (144), Expect(2) = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCV+ + LKLAFSL+EEMKRYQ++PNLV N Sbjct: 582 YTTAIKVCVDGRQLKLAFSLYEEMKRYQVEPNLVTYN 618 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 615 VTYNTLLRA 623 >ref|XP_010037924.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Eucalyptus grandis] Length = 820 Score = 60.1 bits (144), Expect(2) = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCV+ + LKLAFSL+EEMKRYQ++PNLV N Sbjct: 580 YTTAIKVCVDGRQLKLAFSLYEEMKRYQVEPNLVTYN 616 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 613 VTYNTLLRA 621 >gb|KCW49699.1| hypothetical protein EUGRSUZ_K03203 [Eucalyptus grandis] Length = 570 Score = 60.1 bits (144), Expect(2) = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCV+ + LKLAFSL+EEMKRYQ++PNLV N Sbjct: 330 YTTAIKVCVDGRQLKLAFSLYEEMKRYQVEPNLVTYN 366 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 363 VTYNTLLRA 371 >ref|XP_009602545.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Nicotiana tomentosiformis] Length = 856 Score = 58.5 bits (140), Expect(2) = 6e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT+IKVCVE KD K AFSLF MKRYQI+PN+V N Sbjct: 586 YTTIIKVCVETKDFKSAFSLFAAMKRYQIKPNMVTYN 622 Score = 21.6 bits (44), Expect(2) = 6e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 619 VTYNTLLRA 627 >ref|XP_011004144.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Populus euphratica] Length = 854 Score = 58.5 bits (140), Expect(2) = 6e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K+LKLAFSLF EMKR QI PNLV N Sbjct: 587 YTTAIKVCVETKNLKLAFSLFAEMKRCQINPNLVTYN 623 Score = 21.6 bits (44), Expect(2) = 6e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 620 VTYNTLLRA 628 >ref|XP_009602546.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 849 Score = 58.5 bits (140), Expect(2) = 6e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT+IKVCVE KD K AFSLF MKRYQI+PN+V N Sbjct: 579 YTTIIKVCVETKDFKSAFSLFAAMKRYQIKPNMVTYN 615 Score = 21.6 bits (44), Expect(2) = 6e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 612 VTYNTLLRA 620 >ref|XP_006381507.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336211|gb|ERP59304.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 828 Score = 58.5 bits (140), Expect(2) = 6e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT IKVCVE K+LKLAFSLF EMKR QI PNLV N Sbjct: 583 YTTAIKVCVETKNLKLAFSLFAEMKRCQINPNLVTYN 619 Score = 21.6 bits (44), Expect(2) = 6e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 616 VTYNTLLRA 624 >ref|XP_006428907.1| hypothetical protein CICLE_v10011055mg [Citrus clementina] gi|568853887|ref|XP_006480569.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Citrus sinensis] gi|557530964|gb|ESR42147.1| hypothetical protein CICLE_v10011055mg [Citrus clementina] Length = 850 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLV 113 YTT IKVCV K LKLAFSLFEEMK YQIQPNLV Sbjct: 586 YTTAIKVCVRSKRLKLAFSLFEEMKHYQIQPNLV 619 >ref|XP_006367266.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Solanum tuberosum] Length = 859 Score = 57.8 bits (138), Expect(2) = 9e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT+IKVCVE KD K AFSLF MKRYQI+PN+V N Sbjct: 589 YTTIIKVCVENKDFKSAFSLFAAMKRYQIKPNMVTYN 625 Score = 21.6 bits (44), Expect(2) = 9e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 622 VTYNTLLRA 630 >ref|XP_004246707.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Solanum lycopersicum] Length = 857 Score = 57.8 bits (138), Expect(2) = 9e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLVRSN 104 YTT+IKVCVE KD K AFSLF MKRYQI+PN+V N Sbjct: 591 YTTIIKVCVENKDFKSAFSLFAAMKRYQIKPNMVTYN 627 Score = 21.6 bits (44), Expect(2) = 9e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 27 VTYNTLLRA 1 VTYNTLLRA Sbjct: 624 VTYNTLLRA 632 >ref|XP_008447199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Cucumis melo] Length = 748 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 214 YTTVIKVCVECKDLKLAFSLFEEMKRYQIQPNLV 113 YTT IKVCVE K+ KLAFSLFEEMKR++IQPNLV Sbjct: 591 YTTAIKVCVEGKNWKLAFSLFEEMKRFEIQPNLV 624