BLASTX nr result
ID: Ziziphus21_contig00000795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00000795 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009789943.1| PREDICTED: lipid phosphate phosphatase gamma... 85 2e-14 ref|XP_009623454.1| PREDICTED: lipid phosphate phosphatase gamma... 85 2e-14 gb|KDO48096.1| hypothetical protein CISIN_1g027358mg [Citrus sin... 84 5e-14 ref|XP_006480647.1| PREDICTED: dolichyldiphosphatase 1-like isof... 84 5e-14 ref|XP_006428835.1| hypothetical protein CICLE_v10012685mg [Citr... 84 5e-14 ref|XP_014498839.1| PREDICTED: lipid phosphate phosphatase gamma... 83 7e-14 ref|XP_006361792.1| PREDICTED: dolichyldiphosphatase 1-like [Sol... 83 7e-14 ref|XP_007027276.1| Phosphatidic acid phosphatase family protein... 83 7e-14 ref|XP_007027275.1| Phosphatidic acid phosphatase family protein... 83 7e-14 ref|XP_007027274.1| Phosphatidic acid phosphatase family protein... 83 7e-14 ref|XP_004246678.1| PREDICTED: lipid phosphate phosphatase gamma... 83 7e-14 ref|XP_008449810.1| PREDICTED: lipid phosphate phosphatase gamma... 83 9e-14 ref|XP_007144542.1| hypothetical protein PHAVU_007G164600g [Phas... 83 9e-14 ref|XP_004497473.1| PREDICTED: lipid phosphate phosphatase gamma... 83 9e-14 ref|XP_004142166.1| PREDICTED: lipid phosphate phosphatase gamma... 83 9e-14 gb|KJB62496.1| hypothetical protein B456_009G419800 [Gossypium r... 82 2e-13 ref|XP_011077369.1| PREDICTED: LOW QUALITY PROTEIN: lipid phosph... 82 2e-13 emb|CDP06715.1| unnamed protein product [Coffea canephora] 82 2e-13 ref|XP_012082307.1| PREDICTED: lipid phosphate phosphatase gamma... 82 2e-13 ref|XP_004304407.1| PREDICTED: lipid phosphate phosphatase gamma... 82 2e-13 >ref|XP_009789943.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Nicotiana sylvestris] Length = 223 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRYQKGDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 5 PLKAVTLTHVRYQKGDQLGHFLAWVSLVPVFISLGGFVSH 44 >ref|XP_009623454.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Nicotiana tomentosiformis] Length = 223 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRYQKGDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 5 PLKAVTLTHVRYQKGDQLGHFLAWVSLVPVFISLGGFVSH 44 >gb|KDO48096.1| hypothetical protein CISIN_1g027358mg [Citrus sinensis] gi|641828963|gb|KDO48097.1| hypothetical protein CISIN_1g027358mg [Citrus sinensis] gi|641828964|gb|KDO48098.1| hypothetical protein CISIN_1g027358mg [Citrus sinensis] Length = 224 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 5 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSH 44 >ref|XP_006480647.1| PREDICTED: dolichyldiphosphatase 1-like isoform X1 [Citrus sinensis] gi|568854049|ref|XP_006480648.1| PREDICTED: dolichyldiphosphatase 1-like isoform X2 [Citrus sinensis] Length = 224 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 5 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSH 44 >ref|XP_006428835.1| hypothetical protein CICLE_v10012685mg [Citrus clementina] gi|567872493|ref|XP_006428836.1| hypothetical protein CICLE_v10012685mg [Citrus clementina] gi|557530892|gb|ESR42075.1| hypothetical protein CICLE_v10012685mg [Citrus clementina] gi|557530893|gb|ESR42076.1| hypothetical protein CICLE_v10012685mg [Citrus clementina] Length = 224 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 5 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVSH 44 >ref|XP_014498839.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Vigna radiata var. radiata] Length = 223 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRYQKGD++GHFLAW+SLVPVFISLGGFVSH Sbjct: 4 PLKAVTLTHVRYQKGDRLGHFLAWISLVPVFISLGGFVSH 43 >ref|XP_006361792.1| PREDICTED: dolichyldiphosphatase 1-like [Solanum tuberosum] Length = 223 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGF+SH Sbjct: 5 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFISH 44 >ref|XP_007027276.1| Phosphatidic acid phosphatase family protein isoform 3, partial [Theobroma cacao] gi|508715881|gb|EOY07778.1| Phosphatidic acid phosphatase family protein isoform 3, partial [Theobroma cacao] Length = 295 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 214 VFTTSR*TMAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 +FT + T PLKAVTLTHVRYQ+GD++GHFLAWVSLVPVFISLGGFVSH Sbjct: 63 IFTMT--THHPLKAVTLTHVRYQRGDRLGHFLAWVSLVPVFISLGGFVSH 110 >ref|XP_007027275.1| Phosphatidic acid phosphatase family protein isoform 2, partial [Theobroma cacao] gi|508715880|gb|EOY07777.1| Phosphatidic acid phosphatase family protein isoform 2, partial [Theobroma cacao] Length = 233 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 214 VFTTSR*TMAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 +FT + T PLKAVTLTHVRYQ+GD++GHFLAWVSLVPVFISLGGFVSH Sbjct: 38 IFTMT--THHPLKAVTLTHVRYQRGDRLGHFLAWVSLVPVFISLGGFVSH 85 >ref|XP_007027274.1| Phosphatidic acid phosphatase family protein isoform 1 [Theobroma cacao] gi|508715879|gb|EOY07776.1| Phosphatidic acid phosphatase family protein isoform 1 [Theobroma cacao] Length = 308 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 214 VFTTSR*TMAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 +FT + T PLKAVTLTHVRYQ+GD++GHFLAWVSLVPVFISLGGFVSH Sbjct: 72 IFTMT--THHPLKAVTLTHVRYQRGDRLGHFLAWVSLVPVFISLGGFVSH 119 >ref|XP_004246678.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Solanum lycopersicum] Length = 223 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGF+SH Sbjct: 5 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFISH 44 >ref|XP_008449810.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Cucumis melo] Length = 222 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 241 APLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 APLKAV+LTHVRYQ+GDQ+GHFLAWVSLVPVFISLGGF+SH Sbjct: 4 APLKAVSLTHVRYQRGDQLGHFLAWVSLVPVFISLGGFLSH 44 >ref|XP_007144542.1| hypothetical protein PHAVU_007G164600g [Phaseolus vulgaris] gi|561017732|gb|ESW16536.1| hypothetical protein PHAVU_007G164600g [Phaseolus vulgaris] Length = 223 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRYQKGD++GHFLAW+SLVPVFISLGGFVSH Sbjct: 4 PLKAVTLTHVRYQKGDRVGHFLAWISLVPVFISLGGFVSH 43 >ref|XP_004497473.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Cicer arietinum] Length = 229 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = +1 Query: 220 TTSR*TMAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 TT+ +PLKAVTLTHVRYQ+GD++GHFLAW+SLVPVFISLGGF+SH Sbjct: 5 TTTPSIPSPLKAVTLTHVRYQRGDRLGHFLAWISLVPVFISLGGFISH 52 >ref|XP_004142166.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Cucumis sativus] gi|700198914|gb|KGN54072.1| hypothetical protein Csa_4G280490 [Cucumis sativus] Length = 222 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 241 APLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 APLKAV+LTHVRYQ+GDQ+GHFLAWVSLVPVFISLGGF+SH Sbjct: 4 APLKAVSLTHVRYQRGDQLGHFLAWVSLVPVFISLGGFLSH 44 >gb|KJB62496.1| hypothetical protein B456_009G419800 [Gossypium raimondii] Length = 195 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTL HVRYQ+GDQ+GHFLAWVSLVPVFISLGGFVSH Sbjct: 6 PLKAVTLAHVRYQRGDQLGHFLAWVSLVPVFISLGGFVSH 45 >ref|XP_011077369.1| PREDICTED: LOW QUALITY PROTEIN: lipid phosphate phosphatase gamma, chloroplastic [Sesamum indicum] Length = 215 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 238 MAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 + PLKAVTLTHVRYQ+GDQ+GHFLAW+SLVPVFISLGGF SH Sbjct: 7 LPPLKAVTLTHVRYQRGDQLGHFLAWISLVPVFISLGGFFSH 48 >emb|CDP06715.1| unnamed protein product [Coffea canephora] Length = 227 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +1 Query: 247 LKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 LKAVTLTHVRYQKGDQ+GHFLAWVSL+PVFISLGGFVSH Sbjct: 10 LKAVTLTHVRYQKGDQLGHFLAWVSLIPVFISLGGFVSH 48 >ref|XP_012082307.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Jatropha curcas] gi|802683469|ref|XP_012082308.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Jatropha curcas] gi|643717646|gb|KDP29089.1| hypothetical protein JCGZ_16478 [Jatropha curcas] Length = 221 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 244 PLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 PLKAVTLTHVRY+KGDQ+GHFLAWVSLVPVFISLGGFV H Sbjct: 6 PLKAVTLTHVRYRKGDQLGHFLAWVSLVPVFISLGGFVCH 45 >ref|XP_004304407.1| PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Fragaria vesca subsp. vesca] Length = 220 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 238 MAPLKAVTLTHVRYQKGDQMGHFLAWVSLVPVFISLGGFVSH 363 MAP KAVTLTH+RYQKGD +GHFLAW+SL+PVFIS GGFVSH Sbjct: 1 MAPYKAVTLTHIRYQKGDPLGHFLAWISLIPVFISFGGFVSH 42