BLASTX nr result
ID: Ziziphus21_contig00000590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00000590 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010113187.1| hypothetical protein L484_000231 [Morus nota... 64 4e-08 >ref|XP_010113187.1| hypothetical protein L484_000231 [Morus notabilis] gi|587988797|gb|EXC73152.1| hypothetical protein L484_000231 [Morus notabilis] Length = 159 Score = 63.9 bits (154), Expect = 4e-08 Identities = 43/92 (46%), Positives = 51/92 (55%), Gaps = 1/92 (1%) Frame = -1 Query: 274 MASNSAFALSIPLSFVPCRSNH-QTLGVPTKPSLALFKLANPLNSPRFGAKPTGFSSKPT 98 MAS+S LSIP S VP RSNH + L + SL+ NS F KP+ S P Sbjct: 1 MASSSTLLLSIPSSSVPHRSNHHKPLAIRLPTSLSFVTTPKFPNSTSFKPKPSLSSPNPR 60 Query: 97 LFFRRFRARNSLGDAADDEPPPPLVGEDSAVF 2 L F + A +SLG+A D PPLVGEDSA F Sbjct: 61 LSFSKLLAGSSLGNAED----PPLVGEDSATF 88