BLASTX nr result
ID: Zingiber25_contig00023416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00023416 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY26884.1| Integrase-type DNA-binding superfamily protein [T... 56 6e-06 >gb|EOY26884.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao] Length = 239 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 271 KDGGGKRPRERSSRHPAFRGVRMRSWGKWVSE 366 +D K+PR+ SS+HP +RGVRMRSWGKWVSE Sbjct: 44 EDSRAKKPRDSSSKHPVYRGVRMRSWGKWVSE 75