BLASTX nr result
ID: Zingiber24_contig00029347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00029347 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma ... 57 3e-06 gb|ESW04745.1| hypothetical protein PHAVU_011G1221001g, partial ... 55 7e-06 gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybri... 55 1e-05 >gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao] Length = 364 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 4 GKERSEAEWKSIFIAAGFSDYTISPISGLRSLIQLF 111 GKER+E EW ++F+AAGFSDY I+PI GLRSLI+++ Sbjct: 328 GKERNEEEWATLFLAAGFSDYKITPIMGLRSLIEVY 363 >gb|ESW04745.1| hypothetical protein PHAVU_011G1221001g, partial [Phaseolus vulgaris] Length = 214 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 1 PGKERSEAEWKSIFIAAGFSDYTISPISGLRSLIQLF 111 PGKER+E EW I +AGFSDY I+P+ GLRSLI+++ Sbjct: 177 PGKERTEKEWAKIIFSAGFSDYKITPVVGLRSLIEIY 213 >gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar] gi|27527922|emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis] gi|53748110|emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis] Length = 367 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 4 GKERSEAEWKSIFIAAGFSDYTISPISGLRSLIQLF 111 GKER+E EW +F AGFSDY I+PISGLRSLI+++ Sbjct: 331 GKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVY 366