BLASTX nr result
ID: Zingiber24_contig00017582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017582 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486122.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003614565.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_006352610.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003634853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 58 1e-06 ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 emb|CAN77919.1| hypothetical protein VITISV_027645 [Vitis vinifera] 58 1e-06 gb|EXB88431.1| hypothetical protein L484_012870 [Morus notabilis] 58 1e-06 ref|XP_003546143.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|ESW19733.1| hypothetical protein PHAVU_006G150800g [Phaseolus... 57 3e-06 ref|XP_004248402.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|NP_564786.1| pentatricopeptide repeat-containing protein [Ar... 56 4e-06 ref|XP_006302331.1| hypothetical protein CARUB_v10020389mg [Caps... 56 6e-06 >ref|XP_004486122.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cicer arietinum] Length = 394 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/62 (54%), Positives = 43/62 (69%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K+KSR LR ++SETNP IV+ICRAASL P S L RLA S A++ L +++F VR Sbjct: 27 KQKSRAALRLLKSETNPETIVEICRAASLSP-ESHLDRLAFSRAVNKLTAAKNFDAVRQF 85 Query: 315 LD 320 LD Sbjct: 86 LD 87 >ref|XP_003614565.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515900|gb|AES97523.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 140 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/62 (54%), Positives = 40/62 (64%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR LR + SETNP I+ ICRAASL P S L RLALS A+S L ++F +R Sbjct: 23 KEKSRSTLRLLNSETNPETILSICRAASLSP-DSHLDRLALSTAVSKLTAGKNFDILRQF 81 Query: 315 LD 320 LD Sbjct: 82 LD 83 >ref|XP_006352610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Solanum tuberosum] Length = 402 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR L ++SETNP RI+DICRAA+L P S L R+A S AIS L + F+ +RS Sbjct: 39 KDKSRAALTLLKSETNPQRILDICRAAALTP-ESHLDRIAYSKAISKLKDLNHFSGIRSF 97 Query: 315 L 317 L Sbjct: 98 L 98 >ref|XP_003634853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Vitis vinifera] Length = 336 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR L ++SE +P RI++ICRAA+L P S L R+A S AIS LA+S+ F +R Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTP-ESHLDRVAFSVAISKLADSKHFDSIRHF 91 Query: 315 LD 320 LD Sbjct: 92 LD 93 >ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Vitis vinifera] Length = 396 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR L ++SE +P RI++ICRAA+L P S L R+A S AIS LA+S+ F +R Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTP-ESHLDRVAFSVAISKLADSKHFDSIRHF 91 Query: 315 LD 320 LD Sbjct: 92 LD 93 >emb|CAN77919.1| hypothetical protein VITISV_027645 [Vitis vinifera] Length = 396 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR L ++SE +P RI++ICRAA+L P S L R+A S AIS LA+S+ F +R Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTP-ESHLDRVAFSVAISKLADSKHFDSIRHF 91 Query: 315 LD 320 LD Sbjct: 92 LD 93 >gb|EXB88431.1| hypothetical protein L484_012870 [Morus notabilis] Length = 394 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K K+R L I++E NPSRIV++C+AASL P + L R+ LS A+S LA+S F +R Sbjct: 31 KEKTRAALALIKTEKNPSRIVELCKAASLTP-ETYLDRITLSVAVSKLADSNHFDAIRQF 89 Query: 315 LD 320 LD Sbjct: 90 LD 91 >ref|XP_003546143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Glycine max] Length = 388 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/62 (48%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K+K+R + ++SETNP RI+DICRAA+L P S + R A S A+S LA + F +R+ Sbjct: 27 KQKTRSAIHLLKSETNPERILDICRAAALTP-DSHIDRRAFSLAVSKLAAAHHFAGIRTF 85 Query: 315 LD 320 LD Sbjct: 86 LD 87 >gb|ESW19733.1| hypothetical protein PHAVU_006G150800g [Phaseolus vulgaris] Length = 388 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K+K+R L ++SETNP RI+DICRAASL P S L R A S A+S LA + F + Sbjct: 26 KQKTRSALHLLKSETNPERILDICRAASLSP-DSHLDRRAFSLAVSKLAAANHFAGISLF 84 Query: 315 LD 320 LD Sbjct: 85 LD 86 >ref|XP_004248402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Solanum lycopersicum] Length = 402 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KSR L ++SET+P RI+DICRAA+L P S L R+A S AIS L + F+ +RS Sbjct: 39 KDKSRAALTLLKSETDPQRILDICRAAALTP-ESHLDRIAYSKAISKLKDLNHFSGIRSF 97 Query: 315 L 317 L Sbjct: 98 L 98 >ref|NP_564786.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806489|sp|Q8LE47.2|PPR87_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g61870, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 336; Flags: Precursor gi|16226403|gb|AAL16159.1|AF428391_1 At1g61870/F8K4_8 [Arabidopsis thaliana] gi|3367521|gb|AAC28506.1| Similar to gb|U08285 membrane-associated salt-inducible protein from Nicotiana tabacum. ESTs gb|T44131 and gb|T04378 come from this gene [Arabidopsis thaliana] gi|17065564|gb|AAL32936.1| Unknown protein [Arabidopsis thaliana] gi|32815835|gb|AAP88326.1| At1g61870 [Arabidopsis thaliana] gi|332195777|gb|AEE33898.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 408 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 K KS+ L ++SE +P RI++ICRAASL P R+ R+A S A+ LAE + F+ V ++ Sbjct: 44 KEKSKAALSLLKSEKDPDRILEICRAASLTP-DCRIDRIAFSAAVENLAEKKHFSAVSNL 102 Query: 315 LD 320 LD Sbjct: 103 LD 104 >ref|XP_006302331.1| hypothetical protein CARUB_v10020389mg [Capsella rubella] gi|482571041|gb|EOA35229.1| hypothetical protein CARUB_v10020389mg [Capsella rubella] Length = 408 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +3 Query: 135 KRKSRPDLRHIRSETNPSRIVDICRAASLCPSSSRLHRLALSDAISTLAESRSFTEVRSI 314 + KSR L ++SE +P RI++ICRAASL P + R+A S A+ LAE + FT V ++ Sbjct: 44 REKSRAALSLLKSEKDPDRILEICRAASLTP-DCHIDRIAFSAAVENLAEKKHFTAVSNL 102 Query: 315 LD 320 LD Sbjct: 103 LD 104