BLASTX nr result
ID: Zingiber24_contig00012850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00012850 (492 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488016.1| PREDICTED: probable glucuronoxylan glucurono... 55 1e-05 >ref|XP_006488016.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X2 [Citrus sinensis] Length = 454 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/81 (41%), Positives = 43/81 (53%), Gaps = 7/81 (8%) Frame = -1 Query: 222 KHYKWLLWXXXXXXXXXXXXXXXXXXXXL---HPLRLNSNLPARALIEPKNPSS--HSSL 58 K+YKW+LW L H SNLP+RALIE N +S H + Sbjct: 38 KYYKWVLWFSLTLYFFSSYFISHNKPIPLSRTHFSNSKSNLPSRALIESVNTTSLQHPTR 97 Query: 57 P--KVYVYELPSRFNTDWLAN 1 K+YVYELPS++NTDWL+N Sbjct: 98 EDLKIYVYELPSKYNTDWLSN 118